close

SimulationCraft 520-11 (r16468)

for World of Warcraft 5.2.0 Live (build level 16650)

Table of Contents

Raid Summary

 

DPS Chart

Fel_Imp : 222075 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
222075.1 222075.1 368.92 / 0.17% 15492 / 7.0% 23.9 6334.1 5940.7 Mana 0.00% 54.8 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#VZ!....0.
Glyphs
  • Glyph of Imp Swarm
  • Glyph of Everlasting Affliction
Professions
  • herbalism: 600
  • tailoring: 600

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Fel_Imp Damage Per Execute Time&chts=dddddd,18&chs=550x240&chd=t:1638283|1296639|187085|172891|93173|89793|59986&chds=0,3276566&chco=C79C6E,9482C9,C41F3B,9482C9,74FB0A,C41F3B,9482C9&chm=t++1638283++imp_swarm,C79C6E,0,0,15|t++1296639++doom,9482C9,1,0,15|t++187085++soul_fire_meta,C41F3B,2,0,15|t++172891++hand_of_guldan,9482C9,3,0,15|t++93173++touch_of_chaos,74FB0A,4,0,15|t++89793++soul_fire,C41F3B,5,0,15|t++59986++shadow_bolt,9482C9,6,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fel_Imp Damage Sources&chts=dddddd,18&chs=550x275&chd=t:24,23,21,17,14,10,10,6,4,3,2,2,1&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,C41F3B,74FB0A,9482C9,C41F3B,9482C9,AC5102,9482C9,336600,9482C9,9482C9,336600&chl=soul_fire_meta|wild_imp: firebolt|fel_imp: felbolt|touch_of_chaos|doom|soul_fire|shadow_bolt|shadowflame|corruption|stormlash|terrorguard: doom_bolt|hand_of_guldan|fel_imp: stormlash&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fel_Imp DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:sxwz011211123568751yvtppljggdcaZYZZXWWWWXVVVVVWWUUUUUUTTTTSTTSSSSTTSSSSSTTSSSSTTSRRRRSSRRSSTTSSSSSTSSSSSTTSSSSSTSSTUVWXXYZaaccdeefhhhhgffedcbaZYXVVUTSRQPPPPPOOOOOONNNNNNNNNNNNNOOOOOPPPPQPQQQQQPQQPQPPQPPPPPPPPPPPOOPOOOOOOOOPOPPPPPPPPPPQRRSTUVVWXYZaabcddeeedcbaaZYXWVVUTSRQQPPOOPPOOOOOOOOOOOOOOOOOPPPQQQQQRRRRRRRSSSSSSSSSRRRRRRRRRQQQQQQQQQQQQQQQQQQQQRRRRRRSSTVVXYZbcdefghijkllllkkihgfdcbZYYWVUTSSRRRRRRQRQQQQQQQQQRRRRRRRRRRRRRSSSSSSSSSSSSSSSSSSSTSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTUUVVWWXYYZaabbcddefefeddcbbaZZXXWVUUTSRRQQQQQQQQQQQQQQQQQQRRRRRRSSSTSTTTTTTTTTTTTTSSSSSRRRRRRR&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3600,0.4&chxt=x,y&chxl=0:|0|sec=569|1:|0|avg=222075|max=616817&chxp=1,1,36,100& http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Fel_Imp DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,1,2,2,6,13,13,20,29,39,42,51,70,89,91,110,124,121,120,110,129,124,130,109,108,97,100,90,91,70,75,57,56,38,32,25,22,17,17,18,13,9,5,4,2,2,2,1,2&chds=0,130&chbh=5&chxt=x&chxl=0:|min=194184|avg=222075|max=254776&chxp=0,1,46,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fel_Imp Spent Time&chts=dddddd,18&chs=550x275&chd=t:27.1,24.0,17.3,6.3,1.8,1.6,1.2,1.1,0.2&chds=0,100&chdls=ffffff&chco=74FB0A,9482C9,C41F3B,9482C9,9482C9,9482C9,9482C9,C79C6E,C79C6E&chl=touch_of_chaos 122.4s|shadow_bolt 108.2s|soul_fire 78.0s|hand_of_guldan 28.5s|life_tap 8.0s|doom 7.2s|corruption 5.4s|imp_swarm 4.8s|summon_terrorguard 1.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fel_Imp 222075
berserking 0 0.0% 3.0 180.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 3.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
cancel_metamorphosis 0 0.0% 17.7 22.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.68 17.68 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 17.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
corruption 6765 3.1% 5.1 90.47sec 602417 565614 0 0 0 0.0% 0.0% 0.0% 0.0% 362.6 5753 13132 8399 35.9% 0.0% 99.2%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.06 5.06 362.62 362.62 1.0653 1.2339 3045832.83 3045832.83 0.00 6726.44 565614.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 232.6 64.14% 5753.19 4926 10607 5757.12 5338 6352 1338064 1338064 0.00
crit 130.0 35.86% 13132.09 9852 27739 13100.18 11235 17017 1707769 1707769 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over {$d=18 seconds}.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.150000
  • base_td:160.23
  • num_ticks:14
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 4.3 120.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 4.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by {$s1=18000}.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${{$113861m1=30}} for {$113861d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your Mastery by ${{$113861m1=30}/{$56228m1=10}}. This effect is disabled while on cooldown.][]
doom 20663 9.3% 6.9 66.45sec 1343893 1296639 0 0 0 0.0% 0.0% 0.0% 0.0% 52.9 68767 178631 175206 96.9% 0.0% 98.0%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 52.92 52.92 1.0366 8.3567 9272268.59 9272268.59 0.00 20632.23 1296639.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.6 3.12% 68766.73 54342 123802 34447.87 0 123802 113437 113437 0.00
crit 51.3 96.88% 178630.82 108685 297125 179193.34 141329 227836 9158831 9158831 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=15}/2000}.2][{$t1=15}] sec.
  • description:Inflicts impending doom upon the target, causing $o3 Shadow damage over {$d=60 seconds}. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.937500
  • base_td:1001.44
  • num_ticks:6
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
firebolt 17636 7.9% 229.7 1.98sec 34411 20514 25356 54801 34346 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.71 230.15 0.00 0.00 1.6775 0.0000 7904716.40 7904716.40 0.00 20513.61 20513.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.88 69.47% 25356.24 17775 33230 25400.80 21700 30169 4053975 4053975 0.00
crit 70.27 30.53% 54800.51 35550 66460 54923.16 47681 62390 3850741 3850741 0.00
DPS Timeline Chart
hand_of_guldan 2526 (10929) 1.1% (4.9%) 26.5 16.47sec 186213 172891 33706 71044 43204 25.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.47 26.37 0.00 0.00 1.0771 0.0000 1139335.94 1139335.94 0.00 172891.41 172891.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.66 74.56% 33705.53 29624 55382 33718.79 30604 39069 662733 662733 0.00
crit 6.71 25.44% 71044.44 59248 132916 71083.53 59248 103111 476603 476603 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for {$86040s1=6740} Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 {$@spelldesc47960=Reduces movement speed by {$47960s2=30}% and deals $47960o1 Shadowflame damage over {$47960d=6 seconds}. Generates 2 Demonic Fury every time it deals damage.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.575000
  • base_dd_min:614.22
  • base_dd_max:614.22
imp_swarm 0 (17636) 0.0% (7.9%) 4.7 111.11sec 1697653 1638283 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: imp_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 4.66 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 1638283.19 1638283.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: imp_swarm

Static Values
  • id:104316
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:65.01
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
Spelldata
  • id:104316
  • name:Imp Swarm
  • school:physical
  • tooltip:
  • description:Summons {$104316s1=5} $104316lWild Imp:Wild Imps; from the Twisting Nether to attack the target. The Wild Imps passive effect is disabled while Imp Swarm is on cooldown. Imp Swarm's cooldown is reduced by spell haste. Also increases Wild Imp's cooldown by {$s3=4} sec.
life_tap 0 0.0% 7.5 56.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.49 7.49 0.00 0.00 1.0734 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<60
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:{$?s63320=false}[Places a stacking heal absorb effect on you for {$d=0 milliseconds} equal to {$m3=15}% of your total health and restores][Restores] ${{$m1=15}*$MHP*0.01} mana.{$?s63320=false}[ Lasts {$d=0 milliseconds}.][]
lifeblood 0 0.0% 4.3 120.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lifeblood

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 4.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lifeblood

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
metamorphosis 0 0.0% 20.8 22.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.84 20.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 20.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${{$104315m1=0}*{$m3=300}/100+{$77219m1=0}*{$m3=300}/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
shadow_bolt 14395 6.5% 66.3 4.84sec 97802 59986 78979 164123 97805 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.34 66.34 0.00 0.00 1.6304 0.0000 6487934.01 6487934.01 0.00 59986.26 59986.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.67 77.89% 78979.29 71098 132917 79000.31 73275 88511 4080849 4080849 0.00
crit 14.67 22.11% 164123.05 142196 319001 164132.39 144995 209331 2407085 2407085 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s3=16177} Shadow damage.$?a104315[ Generates {$s2=25} Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.380000
  • base_dd_min:1474.12
  • base_dd_max:1474.12
shadowflame 8403 3.8% 26.4 16.46sec 143737 0 0 0 0 26.6% 0.0% 0.0% 0.0% 238.9 12094 26209 15869 26.7% 0.0% 34.4%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.37 26.37 238.85 238.85 0.0000 0.6489 3790489.82 3790489.82 0.00 24456.35 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.36 73.42% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.01 26.58% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.0 73.25% 12094.19 7058 39973 12095.34 10394 14588 2116151 2116151 0.00
crit 63.9 26.75% 26208.82 14116 108546 26107.84 18939 44997 1674339 1674339 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every {$t1=1} sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by {$47960s2=30}% and deals $47960o1 Shadowflame damage over {$47960d=6 seconds}. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 15539 7.0% 55.3 7.70sec 126703 89793 0 127529 127529 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.29 54.93 0.00 0.00 1.4111 0.0000 7005007.04 7005007.04 0.00 89792.82 89792.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 54.93 100.00% 127528.53 105690 448605 127547.45 112961 151290 7005007 7005007 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burn the enemy's soul, causing {$s1=9920 to 10102} Fire damage.{$?s108869=false}&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates {$s2=30} Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.854000
  • base_dd_min:821.02
  • base_dd_max:1003.47
soul_fire_meta 36299 16.4% 68.8 6.48sec 237410 187085 0 239079 239079 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire_meta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.81 68.33 0.00 0.00 1.2690 0.0000 16336628.53 16336628.53 0.00 187084.91 187084.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 68.33 100.00% 239079.41 148640 768834 239383.82 186995 310959 16336629 16336629 0.00
DPS Timeline Chart

Action details: soul_fire_meta

Static Values
  • id:104027
  • school:fire
  • resource:demonic_fury
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:160.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
Spelldata
  • id:104027
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:{$@spelldesc6353=Burn the enemy's soul, causing {$s1=9920 to 10102} Fire damage.{$?s108869=false}&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates {$s2=30} Demonic Fury.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.854000
  • base_dd_min:821.02
  • base_dd_max:1003.47
stormlash 4287 1.9% 29.5 11.23sec 63838 0 45248 109594 63848 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.46 29.46 0.00 0.00 0.0000 0.0000 1880498.26 1880498.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.94 71.10% 45247.91 15034 129667 45307.04 28326 84194 947763 947763 0.00
crit 8.51 28.90% 109594.24 30068 311200 110044.59 41566 229899 932735 932735 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:15193.86
  • base_dd_max:15193.86
touch_of_chaos 25316 11.4% 118.1 3.74sec 96573 93173 73255 165425 96631 25.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.06 117.99 0.00 0.00 1.0365 0.0000 11401034.34 11401034.34 0.00 93173.11 93173.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.06 74.64% 73254.80 55574 126609 73322.54 65145 83968 6450962 6450962 0.00
crit 29.92 25.36% 165425.02 111148 303860 165896.28 132574 210314 4950072 4950072 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:
  • description:Unleashes energy at the enemy, causing {$s1=8950 to 9032} Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.767000
  • base_dd_min:778.35
  • base_dd_max:860.28
pet - fel_imp 32026 / 32026
felbolt 31178 14.1% 161.5 2.79sec 86893 56552 66706 146832 87368 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: felbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.53 160.65 0.00 0.00 1.5365 0.0000 14035519.85 14035519.85 0.00 56552.42 56552.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.22 74.21% 66705.91 56075 104831 66735.10 63214 71925 7952850 7952850 0.00
crit 41.43 25.79% 146831.64 112150 251595 147098.43 130616 170212 6082670 6082670 0.00
DPS Timeline Chart

Action details: felbolt

Static Values
  • id:115746
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:1.5000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115746
  • name:Felbolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=10632} Fire damage to a target.$?a104315[ Master gains {$s3=8} Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.907000
  • base_dd_min:968.86
  • base_dd_max:968.86
stormlash 849 0.4% 18.0 18.82sec 20844 0 14075 35375 20846 31.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.00 18.00 0.00 0.00 0.0000 0.0000 375194.30 375194.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.28 68.22% 14075.37 9821 18537 14066.25 10436 17073 172845 172845 0.00
crit 5.72 31.78% 35374.96 19643 44489 35653.52 24337 44489 202349 202349 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:8272.21
  • base_dd_max:8272.21
pet - terrorguard 28022 / 3799
doom_bolt 28022 1.7% 17.0 3.40sec 98902 29089 72033 160376 98910 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 3.4000 0.0000 1681335.96 1681335.96 0.00 29088.86 29088.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.83 69.59% 72032.81 55642 104021 72024.93 56936 88810 852138 852138 0.00
crit 5.17 30.41% 160376.45 111283 208043 162275.10 125919 208043 829198 829198 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=10502 to 10598} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - wild_imp 41674 / 34420
firebolt 41674 15.5% 591.3 0.75sec 26215 14336 20997 43054 28638 24.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 591.30 587.16 0.00 0.00 1.8287 0.0000 15501177.16 15501177.16 0.00 14335.78 14335.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 443.32 75.50% 20997.10 17775 33230 21005.67 19695 30169 9308381 9308381 0.00
crit 143.84 24.50% 43053.66 35550 66460 43070.95 39681 62390 6192796 6192796 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=4035 to 4053} Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.345000
  • base_dd_min:359.32
  • base_dd_max:377.74

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 6.68% 7.39%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserking_1:6.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.04% 11.18%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.9 1.9 79.5sec 57.7sec 29.81% 29.81%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:29.81%

    Trigger Attempt Success

    • trigger_pct:99.89%
dark_soul 4.3 0.0 120.8sec 120.8sec 18.61% 30.73%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:18.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by {$s1=18000}.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${{$113861m1=30}} for {$113861d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your Mastery by ${{$113861m1=30}/{$56228m1=10}}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 8.9 0.0 48.8sec 43.8sec 2.95% 2.89%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • demonic_calling_1:2.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,{$?s114168=false}[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,{$?s114168=false}[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
jade_serpent_potion 2.0 0.0 363.8sec 0.0sec 10.17% 10.17%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.17%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.6 12.7 31.4sec 16.5sec 53.71% 53.71%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:53.71%

    Trigger Attempt Success

    • trigger_pct:99.56%
lifeblood 4.3 0.0 120.8sec 120.8sec 18.61% 18.61%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_lifeblood
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:2880.00

    Stack Uptimes

    • lifeblood_1:18.61%

    Trigger Attempt Success

    • trigger_pct:100.00%
lightweave_embroidery_3 8.1 0.0 58.7sec 58.7sec 26.59% 26.59%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:2000.00

    Stack Uptimes

    • lightweave_embroidery_3_1:26.59%

    Trigger Attempt Success

    • trigger_pct:99.91%
metamorphosis 20.8 0.0 22.1sec 22.1sec 49.27% 65.21%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • metamorphosis_1:49.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${{$104315m1=0}*{$m3=300}/100+{$77219m1=0}*{$m3=300}/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
molten_core 36.9 96.5 9.4sec 3.3sec 54.77% 100.00%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_molten_core
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • molten_core_1:22.84%
  • molten_core_2:7.94%
  • molten_core_3:3.10%
  • molten_core_4:1.79%
  • molten_core_5:1.51%
  • molten_core_6:1.39%
  • molten_core_7:1.29%
  • molten_core_8:1.27%
  • molten_core_9:3.04%
  • molten_core_10:10.61%

Trigger Attempt Success

  • trigger_pct:91.68%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants {$s3=0} additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by {$122355s1=50}%. $?({$m3=0}>0)[Soul Fire grants {$s3=0} additional Demonic Fury. ][] Lasts {$d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
perfect_aim 8.2 0.5 56.1sec 52.3sec 7.48% 7.48%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_perfect_aim
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • perfect_aim_1:7.48%

Trigger Attempt Success

  • trigger_pct:99.80%

Spelldata details

  • id:138963
  • name:Perfect Aim
  • tooltip:Critical strike chance increased by {$s1=100}%.
  • description:Critical strike chance increased by {$s1=100}% for {$d=4 seconds}.
  • max_stacks:
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 5.8 0.0 76.0sec 76.0sec 12.79% 15.27%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.04% 9.04%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 8.1 2.1 57.2sec 44.5sec 20.03% 22.32%

Buff details

  • buff initial source:Fel_Imp
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:20.03%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
fel_imp-skull_banner 5.8 0.0 76.0sec 76.0sec 12.79% 24.05%

Buff details

  • buff initial source:Fel_Imp_fel_imp
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
fel_imp-stormlash 4.0 0.0 103.7sec 103.7sec 9.04% 9.04%

Buff details

  • buff initial source:Fel_Imp_fel_imp
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fel_Imp
corruption Mana 5.1 18957.0 3750.0 3749.4 160.7
dark_soul Mana 4.3 64962.0 15000.0 14999.5 0.0
doom Demonic Fury 6.9 355.9 51.6 51.6 26053.8
firebolt Energy 229.7 229.7 1.0 1.0 34409.9
hand_of_guldan Mana 26.5 397116.0 15000.0 15000.1 12.4
shadow_bolt Mana 66.3 1094570.4 16500.0 16500.1 5.9
soul_fire Mana 55.3 1243953.0 22500.0 22500.0 5.6
soul_fire_meta Demonic Fury 68.8 4831.2 70.2 70.2 3381.5
summon_terrorguard Mana 1.0 37500.0 37500.0 37500.0 0.0
touch_of_chaos Demonic Fury 118.1 4288.6 36.3 36.3 2658.5
pet - fel_imp
felbolt Energy 161.5 6461.1 40.0 40.0 2172.3
pet - terrorguard
doom_bolt Energy 17.0 595.0 35.0 35.0 2825.8
pet - wild_imp
firebolt Energy 821.0 821.0 1.0 1.0 26216.1
Resource Gains Type Count Total Average Overflow
fel_imp Demonic Fury 161.53 1289.16 (13.70%) 7.98 3.05 0.24%
wild_imp Demonic Fury 821.01 4090.66 (43.48%) 4.98 14.38 0.35%
metamorphosis Demonic Fury 212.82 -1276.69 (-13.57%) -6.00 -0.25 0.02%
soul_fire Demonic Fury 55.29 1656.31 (17.61%) 29.96 2.30 0.14%
corruption Demonic Fury 367.68 1467.02 (15.59%) 3.99 3.70 0.25%
shadowflame Demonic Fury 262.92 523.53 (5.57%) 1.99 2.30 0.44%
life_tap Mana 7.49 682201.23 (25.46%) 91037.85 0.00 0.00%
shadow_bolt Demonic Fury 66.34 1657.08 (17.62%) 24.98 1.36 0.08%
mp5_regen Mana 1803.76 1997425.58 (74.54%) 1107.37 145873.08 6.81%
pet - fel_imp
energy_regen Energy 1803.76 6388.19 (100.00%) 3.54 17.04 0.27%
pet - terrorguard
energy_regen Energy 240.00 590.42 (100.00%) 2.46 426.96 41.97%
Resource RPS-Gain RPS-Loss
Health 0.00 1512.43
Mana 5940.70 6334.07
Demonic Fury 23.69 23.84
Combat End Resource Mean Min Max
Health -75263.78 -485535.20 242767.60
Mana 122547.12 5857.66 248966.31
Demonic Fury 132.34 0.00 753.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.6%
felhunter-Mana Cap 5.6%
succubus-Mana Cap 5.6%
infernal-Mana Cap 5.6%
observer-Mana Cap 5.6%
shivarra-Mana Cap 5.6%
abyssal-Mana Cap 5.6%
felguard-Mana Cap 5.6%
service_felguard-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
wild_imp-Mana Cap 5.6%
service_felhunter-Mana Cap 5.6%
service_succubus-Mana Cap 5.6%

Procs

Count Interval
wild_imp 60.2 7.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 2499
Mean 451.06
Minimum 347.21
Maximum 569.98
Spread ( max - min ) 222.77
Range [ ( max - min ) / 2 * 100% ] 24.69%
Distribution Chart

DPS

Sample Data Fel_Imp Damage Per Second
Count 2499
Mean 222075.12
Minimum 194184.11
Maximum 254775.94
Spread ( max - min ) 60591.83
Range [ ( max - min ) / 2 * 100% ] 13.64%
Standard Deviation 9409.6014
5th Percentile 207463.62
95th Percentile 238448.09
( 95th Percentile - 5th Percentile ) 30984.47
Mean Distribution
Standard Deviation 188.2297
95.00% Confidence Intervall ( 221706.20 - 222444.05 )
Normalized 95.00% Confidence Intervall ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6896
0.1 Scale Factor Error with Delta=300 755833
0.05 Scale Factor Error with Delta=300 3023333
0.01 Scale Factor Error with Delta=300 75583347
Distribution Chart

DPS(e)

Sample Data
Count 2499
Mean 222075.12
Distribution Chart

Damage

Sample Data
Count 2499
Mean 68263745.77
Distribution Chart

DTPS

Sample Data Fel_Imp Damage Taken Per Second
Count 2499
Mean 0.00
Distribution Chart

HPS

Sample Data Fel_Imp Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 2499
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 2499
Mean 0.00
Distribution Chart

HTPS

Sample Data Fel_Imp Healing taken Per Second
Count 2499
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 2499
Mean 411.96
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet,if=!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down
4 0.00 snapshot_stats
5 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
6 0.00 service_pet,if=talent.grimoire_of_service.enabled
7 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
A 4.33 lifeblood
B 3.04 berserking
C 4.66 imp_swarm,if=buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
D 4.33 dark_soul
E 0.00 service_pet,if=talent.grimoire_of_service.enabled
F 0.00 felguard:felstorm
G 0.00 wrathguard:wrathstorm
H 0.00 run_action_list,name=aoe,if=active_enemies>4
I 1.00 summon_doomguard
J 0.00 metamorphosis,if=buff.perfect_aim.react&active_enemies>1
K 4.52 doom,cycle_targets=1,if=buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
L 0.50 touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
M 3.29 soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
N 2.37 doom,cycle_targets=1,if=buff.metamorphosis.up&(ticks_remain<=1|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react&dot.doom.crit_pct<100
O 16.36 touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<20&dot.corruption.crit_pct<100
P 17.68 cancel_metamorphosis,if=buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
Q 65.84 soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
R 101.20 touch_of_chaos,if=buff.metamorphosis.up
S 3.77 corruption,cycle_targets=1,if=buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
T 1.61 hand_of_guldan,if=buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
U 1.28 corruption,cycle_targets=1,if=!ticking&target.time_to_die>=6&miss_react
V 20.84 metamorphosis,if=(buff.dark_soul.up&demonic_fury%32>buff.dark_soul.remains)|(dot.corruption.remains<5&dot.corruption.crit_pct<100)|!dot.doom.ticking|demonic_fury>=950|demonic_fury%32>target.time_to_die|buff.perfect_aim.react
W 24.86 hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time&(charges=2|dot.shadowflame.remains>travel_time|(charges=1&recharge_time<4))
X 55.63 soul_fire,if=buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
Y 7.49 life_tap,if=mana.pct<60
Z 66.34 shadow_bolt
a 0.00 fel_flame,moving=1
b 0.00 life_tap

Sample Sequence

ABDCIUVNKRRRQORRQQQQRWVRXXXWXZZSVMPZZZZYZZZZZXZWZZYWVQRRQQRRPZZXZZZZVRRRRRRRRRRPWZZWXXXXVQRRRQQQPXXYZZZWXVOQQRKRQADCRRRRQRRRQQQRRQRRRPWZZWXXXXXXXVQRRRRRRRPZWYZZWXXXVQRBRRRRRRRKMPVPZZZZZWZZWXXVQRRRRRRRRRPZYZZZZWZVQRRRRRRQRRADCRRQQRRQQQRRRQQQRPWZXXWXXXXYZXZSVKRRRRRRRRRPWXXZWZZXVQRRRRRRRRPZZZWZYZSVQRRRRRPZWZZWZZZVQRQRQQPXXXXSTVKABDCQQQQQ9KMQQQQQMQQQQPWXXXXWXXXXXXXXXXVQLOOOOQQPWXXXYWXXVOOOOQQQOQQCOQQQOQQQORWXVQRR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 155 148 80
Agility 167 159 80
Stamina 32894 29904 27081
Intellect 23928 21424 20220
Spirit 279 279 80
Health 606919 565059 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 38029 32068 10654
Spell Hit 15.01% 15.01% 4303
Spell Crit 20.11% 14.12% 2378
Spell Haste 41.98% 35.22% 14968
Spell Speed 41.98% 35.22% 14968
ManaReg per Second 4259 4057 0
Attack Power 308 266 0
Melee Hit 12.66% 12.66% 4303
Melee Crit 11.80% 6.79% 2378
Melee Haste 35.22% 35.22% 14968
Swing Speed 48.74% 35.22% 14968
Expertise 2.35% 2.35% 799
Armor 16276 16276 16276
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 25.50% 20.50% 7501

Gear

Source Slot Average Item Level: 540.20
Local Head hood_of_the_crimson_wake,id=96887,gems=sinister_primal_160hit_160mastery_180int
Local Neck megaeras_shining_eye,id=96825,reforge=crit_exp
Local Shoulders mantle_of_the_thousandfold_hells,id=96729,gems=80int_160haste_320haste_120haste,enchant=200int_100crit,reforge=crit_hit
Shirt empty
Local Chest starburner_robes,id=95039,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_mastery
Local Legs leggings_of_the_discarded_warning,id=95030,gems=80int_160mastery_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160mastery_60haste,enchant=140mastery
Local Wrists frostborn_wristwraps,id=96824,suffix=340,gems=320haste_60int,enchant=180int,reforge=haste_mastery
Local Hands gloves_of_the_thousandfold_hells,id=96725,gems=80int_160mastery_60int,enchant=170haste,reforge=crit_hit
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160hit_60int,reforge=haste_exp
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160hit_60haste,reforge=crit_haste
Blizzard Trinket1 unerring_vision_of_leishen,id=96930
Local Trinket2 breath_of_the_hydra,id=96827
Local Back red_sky_cloudcloak,id=95014,gems=320haste_60haste,enchant=lightweave_embroidery_3,reforge=haste_exp
Local Main Hand suenwo_spire_of_the_falling_sun,id=96911,gems=80int_160mastery_320haste_60int,enchant=jade_spirit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Horror Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Fel_Imp"
level=90
race=troll
role=spell
position=back
professions=herbalism=600/tailoring=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#VZ!....0.
talent_override=grimoire_of_sacrifice
talent_override=grimoire_of_service
talent_override=grimoire_of_service
talent_override=grimoire_of_service
talent_override=grimoire_of_service
talent_override=grimoire_of_supremacy
glyphs=imp_swarm/everlasting_affliction
spec=demonology

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet,if=!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/service_pet,if=talent.grimoire_of_service.enabled
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/lifeblood
actions+=/berserking
actions+=/imp_swarm,if=buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/felguard:felstorm
actions+=/wrathguard:wrathstorm
actions+=/run_action_list,name=aoe,if=active_enemies>4
actions+=/summon_doomguard
actions+=/metamorphosis,if=buff.perfect_aim.react&active_enemies>1
actions+=/doom,cycle_targets=1,if=buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
actions+=/touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
actions+=/soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
actions+=/doom,cycle_targets=1,if=buff.metamorphosis.up&(ticks_remain<=1|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react&dot.doom.crit_pct<100
actions+=/touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<20&dot.corruption.crit_pct<100
actions+=/cancel_metamorphosis,if=buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
actions+=/soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
actions+=/touch_of_chaos,if=buff.metamorphosis.up
actions+=/corruption,cycle_targets=1,if=buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
actions+=/hand_of_guldan,if=buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
actions+=/corruption,cycle_targets=1,if=!ticking&target.time_to_die>=6&miss_react
actions+=/metamorphosis,if=(buff.dark_soul.up&demonic_fury%32>buff.dark_soul.remains)|(dot.corruption.remains<5&dot.corruption.crit_pct<100)|!dot.doom.ticking|demonic_fury>=950|demonic_fury%32>target.time_to_die|buff.perfect_aim.react
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time&(charges=2|dot.shadowflame.remains>travel_time|(charges=1&recharge_time<4))
actions+=/soul_fire,if=buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
actions+=/life_tap,if=mana.pct<60
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_infernal
actions.aoe+=/cancel_metamorphosis,if=buff.metamorphosis.up&dot.corruption.remains>10&demonic_fury<=650&buff.dark_soul.down&!dot.immolation_aura.ticking
actions.aoe+=/immolation_aura,if=buff.metamorphosis.up
actions.aoe+=/void_ray,if=buff.metamorphosis.up&dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=buff.metamorphosis.up&(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
actions.aoe+=/void_ray,if=buff.metamorphosis.up
actions.aoe+=/corruption,cycle_targets=1,if=!ticking&target.time_to_die>30&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=dot.corruption.remains<10|buff.dark_soul.up|demonic_fury>=950|demonic_fury%32>target.time_to_die
actions.aoe+=/hellfire,chain=1,interrupt=1
actions.aoe+=/life_tap

head=hood_of_the_crimson_wake,id=96887,gems=sinister_primal_160hit_160mastery_180int
neck=megaeras_shining_eye,id=96825,reforge=crit_exp
shoulders=mantle_of_the_thousandfold_hells,id=96729,gems=80int_160haste_320haste_120haste,enchant=200int_100crit,reforge=crit_hit
back=red_sky_cloudcloak,id=95014,gems=320haste_60haste,enchant=lightweave_embroidery_3,reforge=haste_exp
chest=starburner_robes,id=95039,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all
wrists=frostborn_wristwraps,id=96824,suffix=340,gems=320haste_60int,enchant=180int,reforge=haste_mastery
hands=gloves_of_the_thousandfold_hells,id=96725,gems=80int_160mastery_60int,enchant=170haste,reforge=crit_hit
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_mastery
legs=leggings_of_the_discarded_warning,id=95030,gems=80int_160mastery_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160mastery_60haste,enchant=140mastery
finger1=radens_summoning_band,id=95019,gems=160haste_160hit_60int,reforge=haste_exp
finger2=roshaks_remembrance,id=96901,gems=160haste_160hit_60haste,reforge=crit_haste
trinket1=unerring_vision_of_leishen,id=96930
trinket2=breath_of_the_hydra,id=96827
main_hand=suenwo_spire_of_the_falling_sun,id=96911,gems=80int_160mastery_320haste_60int,enchant=jade_spirit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27081
# gear_intellect=20220
# gear_spirit=80
# gear_spell_power=10654
# gear_expertise_rating=799
# gear_hit_rating=4303
# gear_crit_rating=2378
# gear_haste_rating=14968
# gear_mastery_rating=7501
# gear_armor=16276
# meta_gem=sinister_primal
# tier15_2pc_caster=1
# back=red_sky_cloudcloak,heroic=1,enchant=lightweave_embroidery_3
# trinket1=unerring_vision_of_leishen,heroic=1
# main_hand=suenwo_spire_of_the_falling_sun,heroic=1,weapon=staff_3.30speed_8970min_13455max,enchant=jade_spirit
default_pet=imp

Felguard : 228074 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
228074.0 228074.0 369.56 / 0.16% 15330 / 6.7% 23.9 6312.0 5930.6 Mana 0.00% 56.3 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#VZ!....1.
Glyphs
  • Glyph of Imp Swarm
  • Glyph of Everlasting Affliction
Professions
  • herbalism: 600
  • tailoring: 600

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Felguard Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:1641110|1294805|849306|186984|171488|93060|89122|59867&chds=0,3282220&chco=C79C6E,9482C9,9482C9,C41F3B,9482C9,74FB0A,C41F3B,9482C9&chm=t++1641110++imp_swarm,C79C6E,0,0,15|t++1294805++doom,9482C9,1,0,15|t++849306++service_felguard,9482C9,2,0,15|t++186984++soul_fire_meta,C41F3B,3,0,15|t++171488++hand_of_guldan,9482C9,4,0,15|t++93060++touch_of_chaos,74FB0A,5,0,15|t++89122++soul_fire,C41F3B,6,0,15|t++59867++shadow_bolt,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Felguard Damage Sources&chts=dddddd,18&chs=550x275&chd=t:24,23,17,14,11,10,9,5,5,4,3,3,3,2,2,2,2,0&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,74FB0A,9482C9,C79C6E,C41F3B,9482C9,AC5102,C79C6E,9482C9,C79C6E,336600,C79C6E,9482C9,9482C9,C79C6E,C79C6E,336600&chl=soul_fire_meta|wild_imp: firebolt|touch_of_chaos|doom|felguard: melee|soul_fire|shadow_bolt|shadowflame|felguard: legion_strike|corruption|felguard: felstorm|stormlash|service_felguard: melee|doomguard: doom_bolt|hand_of_guldan|service_felguard: legion_strike|service_felguard: felstorm|felguard: stormlash&
http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Felguard DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:vzz023343334567874zwuspnkhfebaYWWXWVVUUUVTTTTTUUSSSSSTRRRRRSSRRRRSSRRRRQRRQQQQRRQQQQQRQQQRRSSRRRRRSRRRRRSSRRRRQRRRRSTVWWXYZaccdefghihhhggfdcbaZYXVUTSRQPOOOOONNNNNNMMMMMMMMMMMMMNNNNOOOOOOPPPPPPPPPPOPOOOOOOONNNNNNNNNNNNNNNNNNNOOOOOOOOOOPPQRSTUVWXYZabbcdeefeedcbaZYXWVUTTSRQPPOOOOOONNONNNNNNNNNNNNNNOOOOPPPPPQPQQQQQQQQQRRQQQQQQQQQQPPPPPPPPPOOPPPPPPPPPPPPQQQQRSTUWXZacdefghijkllmllkjigfdbaZYXWVUTSRQQQQQQPQQPPPPPPPPQQQQQQQQQQQQQQQQQRRRRRRRRQRRRRRRRRRRRRRRRSSSSSSSSSSSSSSSSSSSSSSSSSTUUVWXYYZabbccdeefeeeddcbaZYXWWVUTSRRQPPPPPPPPPPPPPPPPPPPPPQQQQRRRRRSSSRRRRSSSRRRRRRQQQQQPPP&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3461,0.4&chxt=x,y&chxl=0:|0|sec=569|1:|0|avg=228074|max=658974&chxp=1,1,35,100& http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Felguard DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,4,8,10,11,16,21,37,37,51,80,78,86,96,91,128,131,118,117,121,105,108,133,88,108,95,88,67,74,57,49,55,40,33,37,20,20,14,8,16,11,7,6,4,3,1,3,1,1,3&chds=0,133&chbh=5&chxt=x&chxl=0:|min=204100|avg=228074|max=262019&chxp=0,1,41,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Felguard Spent Time&chts=dddddd,18&chs=550x275&chd=t:26.9,23.7,16.9,6.3,1.7,1.6,1.2,1.1,0.8,0.2&chds=0,100&chdls=ffffff&chco=74FB0A,9482C9,C41F3B,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,C79C6E&chl=touch_of_chaos 121.5s|shadow_bolt 106.7s|soul_fire 76.4s|hand_of_guldan 28.2s|life_tap 7.7s|doom 7.1s|corruption 5.5s|imp_swarm 4.8s|service_felguard 3.5s|summon_doomguard 1.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Felguard 228074
berserking 0 0.0% 3.0 180.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 3.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
cancel_metamorphosis 0 0.0% 18.2 21.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.19 18.19 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
corruption 6729 3.0% 5.1 88.70sec 589910 553549 0 0 0 0.0% 0.0% 0.0% 0.0% 361.4 5755 13062 8384 36.0% 0.0% 99.2%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.14 5.14 361.38 361.38 1.0657 1.2380 3029575.64 3029575.64 0.00 6689.99 553549.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 231.4 64.03% 5755.19 4926 11165 5758.82 5375 6373 1331738 1331738 0.00
crit 130.0 35.97% 13061.55 9852 27739 13038.33 11286 17009 1697837 1697837 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over {$d=18 seconds}.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.150000
  • base_td:160.23
  • num_ticks:14
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 4.3 120.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 4.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by {$s1=18000}.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${{$113861m1=30}} for {$113861d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your Mastery by ${{$113861m1=30}/{$56228m1=10}}. This effect is disabled while on cooldown.][]
doom 20566 9.0% 6.9 66.67sec 1341969 1294805 0 0 0 0.0% 0.0% 0.0% 0.0% 52.9 69380 177731 174562 97.1% 0.0% 98.0%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 52.85 52.85 1.0365 8.3650 9226777.21 9226777.21 0.00 20538.64 1294804.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.5 2.93% 69379.64 54342 118713 32373.59 0 118713 107276 107276 0.00
crit 51.3 97.07% 177731.05 108685 297125 178360.73 141612 240774 9119501 9119501 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=15}/2000}.2][{$t1=15}] sec.
  • description:Inflicts impending doom upon the target, causing $o3 Shadow damage over {$d=60 seconds}. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.937500
  • base_td:1001.44
  • num_ticks:6
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
firebolt 17690 7.7% 230.0 1.97sec 34477 20551 25393 54835 34405 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 230.01 230.48 0.00 0.00 1.6776 0.0000 7929843.39 7929843.39 0.00 20550.72 20550.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.92 69.39% 25392.79 17775 33230 25441.89 22021 29997 4060850 4060850 0.00
crit 70.56 30.61% 54834.64 35550 66460 54977.82 47270 62236 3868993 3868993 0.00
DPS Timeline Chart
hand_of_guldan 2483 (10722) 1.1% (4.7%) 26.2 16.57sec 184792 171488 33493 70053 42962 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.19 26.10 0.00 0.00 1.0776 0.0000 1121154.05 1121154.05 0.00 171488.18 171488.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.34 74.10% 33492.93 29624 55382 33503.55 30686 37301 647607 647607 0.00
crit 6.76 25.90% 70053.19 59248 132916 69977.90 0 99001 473547 473547 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for {$86040s1=6740} Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 {$@spelldesc47960=Reduces movement speed by {$47960s2=30}% and deals $47960o1 Shadowflame damage over {$47960d=6 seconds}. Generates 2 Demonic Fury every time it deals damage.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.575000
  • base_dd_min:614.22
  • base_dd_max:614.22
imp_swarm 0 (17690) 0.0% (7.7%) 4.7 110.72sec 1701148 1641110 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: imp_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 4.66 0.00 0.00 1.0366 0.0000 0.00 0.00 0.00 1641109.97 1641109.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: imp_swarm

Static Values
  • id:104316
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.52
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
Spelldata
  • id:104316
  • name:Imp Swarm
  • school:physical
  • tooltip:
  • description:Summons {$104316s1=5} $104316lWild Imp:Wild Imps; from the Twisting Nether to attack the target. The Wild Imps passive effect is disabled while Imp Swarm is on cooldown. Imp Swarm's cooldown is reduced by spell haste. Also increases Wild Imp's cooldown by {$s3=4} sec.
life_tap 0 0.0% 7.2 59.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.16 7.16 0.00 0.00 1.0733 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<60
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:{$?s63320=false}[Places a stacking heal absorb effect on you for {$d=0 milliseconds} equal to {$m3=15}% of your total health and restores][Restores] ${{$m1=15}*$MHP*0.01} mana.{$?s63320=false}[ Lasts {$d=0 milliseconds}.][]
lifeblood 0 0.0% 4.3 120.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lifeblood

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 4.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lifeblood

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
metamorphosis 0 0.0% 20.7 22.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.71 20.71 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 20.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${{$104315m1=0}*{$m3=300}/100+{$77219m1=0}*{$m3=300}/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
service_felguard 0 (6533) 0.0% (2.9%) 4.3 120.76sec 678914 849306 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: service_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.7994 0.0000 0.00 0.00 0.00 849306.07 849306.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: service_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_service.enabled
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$108501s1=20} sec. Felguard will stun their target when summoned.
shadow_bolt 14174 6.2% 65.4 4.90sec 97687 59867 78933 163655 97683 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.40 65.40 0.00 0.00 1.6317 0.0000 6388807.70 6388807.70 0.00 59866.82 59866.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.93 77.87% 78933.23 71098 132917 78938.13 72954 87174 4019789 4019789 0.00
crit 14.48 22.13% 163655.34 142196 319001 163694.61 143652 198382 2369019 2369019 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s3=16177} Shadow damage.$?a104315[ Generates {$s2=25} Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.380000
  • base_dd_min:1474.12
  • base_dd_max:1474.12
shadowflame 8238 3.6% 26.1 16.56sec 142511 0 0 0 0 26.7% 0.0% 0.0% 0.0% 235.5 12043 25952 15790 26.9% 0.0% 34.0%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.10 26.10 235.53 235.53 0.0000 0.6505 3718928.47 3718928.47 0.00 24274.83 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.13 73.29% 0.00 0 0 0.00 0 0 0 0 0.00
crit 6.97 26.71% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.1 73.06% 12042.89 7058 41508 12041.32 10168 14976 2072362 2072362 0.00
crit 63.4 26.94% 25952.27 14116 95935 25850.84 18902 38657 1646566 1646566 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every {$t1=1} sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by {$47960s2=30}% and deals $47960o1 Shadowflame damage over {$47960d=6 seconds}. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 15103 6.6% 54.0 7.83sec 126017 89122 0 126825 126825 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.04 53.69 0.00 0.00 1.4140 0.0000 6809751.64 6809751.64 0.00 89122.38 89122.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 53.69 100.00% 126824.82 105690 448605 126848.13 110314 152394 6809752 6809752 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burn the enemy's soul, causing {$s1=9920 to 10102} Fire damage.{$?s108869=false}&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates {$s2=30} Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.854000
  • base_dd_min:821.02
  • base_dd_max:1003.47
soul_fire_meta 36709 16.1% 69.6 6.40sec 237402 186984 0 239100 239100 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire_meta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.61 69.12 0.00 0.00 1.2696 0.0000 16525629.66 16525629.66 0.00 186983.82 186983.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 69.12 100.00% 239099.92 148640 768834 239431.07 175255 317225 16525630 16525630 0.00
DPS Timeline Chart

Action details: soul_fire_meta

Static Values
  • id:104027
  • school:fire
  • resource:demonic_fury
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:160.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
Spelldata
  • id:104027
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:{$@spelldesc6353=Burn the enemy's soul, causing {$s1=9920 to 10102} Fire damage.{$?s108869=false}&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates {$s2=30} Demonic Fury.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.854000
  • base_dd_min:821.02
  • base_dd_max:1003.47
stormlash 4380 1.9% 29.5 11.21sec 65149 0 46096 112268 65155 28.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.50 29.50 0.00 0.00 0.0000 0.0000 1921957.69 1921957.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.00 71.19% 46095.75 15034 129667 46059.96 23276 73578 968204 968204 0.00
crit 8.50 28.81% 112267.67 30068 311200 112810.12 42288 311200 953754 953754 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:11408.76
  • base_dd_max:11408.76
touch_of_chaos 25098 11.0% 117.2 3.76sec 96457 93060 72957 165305 96510 25.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.21 117.14 0.00 0.00 1.0365 0.0000 11305258.60 11305258.60 0.00 93060.42 93060.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.26 74.49% 72956.93 55574 126609 73018.92 64897 84468 6366374 6366374 0.00
crit 29.88 25.51% 165304.57 111148 303860 165863.24 132781 219833 4938885 4938885 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:
  • description:Unleashes energy at the enemy, causing {$s1=8950 to 9032} Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.767000
  • base_dd_min:778.35
  • base_dd_max:860.28
pet - doomguard 23426 / 3177
doom_bolt 23426 1.4% 17.0 3.40sec 82679 24317 60067 133613 82679 30.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 3.4000 0.0000 1405548.13 1405548.13 0.00 24317.44 24317.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.77 69.25% 60066.73 46368 86684 60049.95 46843 71910 707210 707210 0.00
crit 5.23 30.75% 133612.85 92736 173369 135248.11 103915 173369 698338 698338 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=10502 to 10598} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - felguard 30279 / 30279
felstorm 4593 2.0% 10.4 45.64sec 199411 0 0 0 0 0.0% 0.0% 0.0% 0.0% 72.0 20794 48359 28686 28.6% 0.0% 13.7%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.36 10.36 72.03 72.02 0.0000 0.8562 2066009.41 2066009.41 0.00 33504.30 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.4 71.37% 20794.12 17802 32982 20804.20 18910 23248 1068908 1068908 0.00
crit 20.6 28.63% 48358.55 35603 79156 48643.46 41518 59368 997101 997101 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for {$89753m1=100}% weapon damage every {$t1=1} sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for {$89753m1=100}% weapon damage every {$89751t1=1} sec for {$89751d=6 seconds}. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for {$89753m1=100}% weapon damage every {$89751t1=1} sec for {$89751d=6 seconds}. The Felguard cannot perform any other abilities during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
legion_strike 7789 3.4% 98.0 4.63sec 35777 34517 27537 60043 35777 25.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.02 98.02 0.00 0.00 1.0365 0.0000 3507019.12 3507019.12 0.00 34516.89 34516.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.18 74.65% 27536.56 23142 42876 27548.02 25929 29772 2015013 2015013 0.00
crit 24.85 25.35% 60042.77 46284 102902 60188.58 52471 72481 1492006 1492006 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does {$s2=1}% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by {$s4=10}% for {$30213d=5 seconds}.$?a104315[ Master gains {$s3=12} Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 17312 7.6% 307.4 1.45sec 25373 19744 21077 44981 25373 23.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 307.41 307.41 0.00 0.00 1.2851 0.0000 7799782.97 7799782.97 0.00 19743.99 19743.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.49 52.86% 21077.26 17802 32982 21085.84 19739 22957 3424802 3424802 0.00
crit 71.13 23.14% 44981.25 35603 79156 45027.17 40362 51134 3199376 3199376 0.00
glance 73.80 24.01% 15930.34 13351 24736 15938.74 14718 17717 1175605 1175605 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
stormlash 585 0.3% 38.4 8.51sec 6741 0 4773 11338 6742 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.40 38.40 0.00 0.00 0.0000 0.0000 258870.65 258870.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.89 70.02% 4773.12 2158 13240 4764.81 3310 6216 128338 128338 0.00
crit 11.51 29.98% 11338.49 4317 31776 11289.65 5921 19451 130533 130533 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5324.09
  • base_dd_max:5324.09
pet - service_felguard 44288 / 8990
felstorm 11363 1.0% 4.3 120.75sec 239634 0 0 0 0 0.0% 0.0% 0.0% 0.0% 30.0 25013 55046 34578 31.8% 0.0% 5.7%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 29.95 29.95 0.0000 0.8557 1035633.47 1035633.47 0.00 40405.50 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.4 68.16% 25013.06 17802 32982 25028.64 22393 30135 510669 510669 0.00
crit 9.5 31.84% 55046.03 35603 65963 55475.61 48791 65963 524964 524964 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for {$89753m1=100}% weapon damage every {$t1=1} sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for {$89753m1=100}% weapon damage every {$89751t1=1} sec for {$89751d=6 seconds}. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for {$89753m1=100}% weapon damage every {$89751t1=1} sec for {$89751d=6 seconds}. The Felguard cannot perform any other abilities during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
legion_strike 12099 1.1% 23.3 18.13sec 47412 45658 34280 73864 47411 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.26 23.26 0.00 0.00 1.0384 0.0000 1102743.28 1102743.28 0.00 45658.47 45658.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.54 66.82% 34279.85 23142 42876 34338.65 29836 40274 532737 532737 0.00
crit 7.72 33.18% 73864.35 46284 85752 74328.81 64435 85752 570006 570006 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does {$s2=1}% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by {$s4=10}% for {$30213d=5 seconds}.$?a104315[ Master gains {$s3=12} Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 20826 1.9% 58.6 7.03sec 32375 27563 26186 54940 32377 26.7% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.65 58.65 0.00 0.00 1.1746 0.0000 1898719.02 1898719.02 0.00 27562.81 27562.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.96 49.39% 26186.47 17802 32982 26243.35 22153 30402 758439 758439 0.00
crit 15.66 26.70% 54939.59 35603 65963 55062.40 46500 63512 860163 860163 0.00
glance 14.03 23.92% 19971.06 13351 24736 20004.53 16771 23509 280117 280117 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - wild_imp 41664 / 34460
firebolt 41664 15.1% 591.3 0.75sec 26255 14350 21011 43058 28684 24.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 591.27 587.18 0.00 0.00 1.8296 0.0000 15523966.32 15523966.32 0.00 14350.34 14350.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 442.63 75.38% 21010.57 17775 33230 21016.98 19833 29997 9299975 9299975 0.00
crit 144.55 24.62% 43058.20 35550 66460 43074.89 39070 62236 6223991 6223991 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=4035 to 4053} Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.345000
  • base_dd_min:359.32
  • base_dd_max:377.74

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 6.68% 7.51%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserking_1:6.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.04% 11.45%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.9 2.0 79.6sec 57.4sec 29.93% 29.93%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:29.93%

    Trigger Attempt Success

    • trigger_pct:99.93%
dark_soul 4.3 0.0 120.8sec 120.8sec 18.60% 32.80%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:18.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by {$s1=18000}.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${{$113861m1=30}} for {$113861d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your Mastery by ${{$113861m1=30}/{$56228m1=10}}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 8.9 0.0 49.0sec 44.0sec 2.97% 2.89%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • demonic_calling_1:2.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,{$?s114168=false}[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,{$?s114168=false}[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
jade_serpent_potion 2.0 0.0 363.8sec 0.0sec 10.17% 10.17%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.17%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.7 12.6 31.4sec 16.5sec 53.72% 53.72%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:53.72%

    Trigger Attempt Success

    • trigger_pct:99.54%
lifeblood 4.3 0.0 120.8sec 120.8sec 18.61% 18.61%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_lifeblood
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:2880.00

    Stack Uptimes

    • lifeblood_1:18.61%

    Trigger Attempt Success

    • trigger_pct:100.00%
lightweave_embroidery_3 8.1 0.0 58.7sec 58.7sec 26.59% 26.59%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:2000.00

    Stack Uptimes

    • lightweave_embroidery_3_1:26.59%

    Trigger Attempt Success

    • trigger_pct:99.92%
metamorphosis 20.7 0.0 22.2sec 22.2sec 49.64% 65.47%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • metamorphosis_1:49.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${{$104315m1=0}*{$m3=300}/100+{$77219m1=0}*{$m3=300}/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
molten_core 36.7 96.3 9.4sec 3.4sec 54.90% 100.00%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_molten_core
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • molten_core_1:22.83%
  • molten_core_2:7.96%
  • molten_core_3:3.10%
  • molten_core_4:1.79%
  • molten_core_5:1.50%
  • molten_core_6:1.41%
  • molten_core_7:1.35%
  • molten_core_8:1.28%
  • molten_core_9:3.04%
  • molten_core_10:10.63%

Trigger Attempt Success

  • trigger_pct:91.67%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants {$s3=0} additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by {$122355s1=50}%. $?({$m3=0}>0)[Soul Fire grants {$s3=0} additional Demonic Fury. ][] Lasts {$d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
perfect_aim 8.3 0.5 55.0sec 51.2sec 7.61% 7.61%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_perfect_aim
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • perfect_aim_1:7.61%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:138963
  • name:Perfect Aim
  • tooltip:Critical strike chance increased by {$s1=100}%.
  • description:Critical strike chance increased by {$s1=100}% for {$d=4 seconds}.
  • max_stacks:
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 5.8 0.0 76.0sec 76.0sec 12.79% 15.10%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.04% 9.04%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 8.0 2.1 57.7sec 44.8sec 19.88% 22.23%

Buff details

  • buff initial source:Felguard
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:19.88%

Trigger Attempt Success

  • trigger_pct:99.79%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
felguard-skull_banner 5.8 0.0 76.0sec 76.0sec 12.79% 21.87%

Buff details

  • buff initial source:Felguard_felguard
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
felguard-stormlash 4.0 0.0 103.7sec 103.7sec 9.04% 9.04%

Buff details

  • buff initial source:Felguard_felguard
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Felguard
corruption Mana 5.1 19260.0 3750.0 3750.3 157.3
dark_soul Mana 4.3 64962.0 15000.0 14999.5 0.0
doom Demonic Fury 6.9 355.9 51.8 51.8 25923.0
firebolt Energy 230.0 230.0 1.0 1.0 34475.5
hand_of_guldan Mana 26.2 392886.0 15000.0 15000.2 12.3
shadow_bolt Mana 65.4 1079172.6 16500.0 16500.9 5.9
soul_fire Mana 54.0 1215810.0 22500.0 22499.0 5.6
soul_fire_meta Demonic Fury 69.6 4898.5 70.4 70.4 3373.6
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 0.0
touch_of_chaos Demonic Fury 117.2 4278.3 36.5 36.5 2642.4
pet - doomguard
doom_bolt Energy 17.0 595.0 35.0 35.0 2362.3
pet - felguard
felstorm Energy 10.4 621.6 60.0 60.0 3323.6
legion_strike Energy 98.0 5881.5 60.0 60.0 596.3
pet - service_felguard
felstorm Energy 4.3 259.3 60.0 60.0 3994.0
legion_strike Energy 23.3 1395.5 60.0 60.0 790.2
pet - wild_imp
firebolt Energy 821.3 821.3 1.0 1.0 26255.1
Resource Gains Type Count Total Average Overflow
felguard Demonic Fury 98.02 1172.28 (12.37%) 11.96 4.02 0.34%
service_felguard Demonic Fury 23.26 278.25 (2.94%) 11.96 0.85 0.31%
wild_imp Demonic Fury 821.29 4084.36 (43.09%) 4.97 22.08 0.54%
metamorphosis Demonic Fury 214.37 -1285.96 (-13.57%) -6.00 -0.25 0.02%
soul_fire Demonic Fury 54.04 1618.60 (17.08%) 29.95 2.48 0.15%
corruption Demonic Fury 366.52 1461.29 (15.42%) 3.99 4.78 0.33%
shadowflame Demonic Fury 259.47 516.21 (5.45%) 1.99 2.73 0.53%
life_tap Mana 7.16 651394.02 (24.35%) 91037.85 0.00 0.00%
shadow_bolt Demonic Fury 65.40 1633.42 (17.23%) 24.97 1.69 0.10%
mp5_regen Mana 1803.76 2023679.55 (75.65%) 1121.92 118766.59 5.54%
pet - doomguard
energy_regen Energy 240.00 590.42 (100.00%) 2.46 426.96 41.97%
pet - felguard
energy_regen Energy 1803.76 6402.45 (100.00%) 3.55 2.74 0.04%
pet - service_felguard
energy_regen Energy 365.10 1267.14 (100.00%) 3.47 141.73 10.06%
Resource RPS-Gain RPS-Loss
Health 0.00 1444.13
Mana 5930.61 6311.97
Demonic Fury 23.86 23.98
Combat End Resource Mean Min Max
Health -44517.11 -394497.35 242767.60
Mana 127995.43 7388.61 268379.09
Demonic Fury 146.15 0.00 855.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.0%
felhunter-Mana Cap 5.0%
succubus-Mana Cap 5.0%
infernal-Mana Cap 5.0%
observer-Mana Cap 5.0%
shivarra-Mana Cap 5.0%
abyssal-Mana Cap 5.0%
felguard-Mana Cap 5.0%
service_felguard-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
wild_imp-Mana Cap 5.0%
service_felhunter-Mana Cap 5.0%
service_succubus-Mana Cap 5.0%

Procs

Count Interval
wild_imp 60.2 7.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 2499
Mean 451.06
Minimum 347.21
Maximum 569.98
Spread ( max - min ) 222.77
Range [ ( max - min ) / 2 * 100% ] 24.69%
Distribution Chart

DPS

Sample Data Felguard Damage Per Second
Count 2499
Mean 228074.05
Minimum 204100.37
Maximum 262019.16
Spread ( max - min ) 57918.79
Range [ ( max - min ) / 2 * 100% ] 12.70%
Standard Deviation 9425.9399
5th Percentile 213779.79
95th Percentile 244440.27
( 95th Percentile - 5th Percentile ) 30660.48
Mean Distribution
Standard Deviation 188.5565
95.00% Confidence Intervall ( 227704.49 - 228443.61 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6561
0.1 Scale Factor Error with Delta=300 758460
0.05 Scale Factor Error with Delta=300 3033842
0.01 Scale Factor Error with Delta=300 75846055
Distribution Chart

DPS(e)

Sample Data
Count 2499
Mean 228074.05
Distribution Chart

Damage

Sample Data
Count 2499
Mean 67977684.05
Distribution Chart

DTPS

Sample Data Felguard Damage Taken Per Second
Count 2499
Mean 0.00
Distribution Chart

HPS

Sample Data Felguard Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 2499
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 2499
Mean 0.00
Distribution Chart

HTPS

Sample Data Felguard Healing taken Per Second
Count 2499
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 2499
Mean 423.23
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet,if=!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down
4 0.00 snapshot_stats
5 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
6 0.00 service_pet,if=talent.grimoire_of_service.enabled
7 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
A 4.33 lifeblood
B 3.04 berserking
C 4.66 imp_swarm,if=buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
D 4.33 dark_soul
E 3.32 service_pet,if=talent.grimoire_of_service.enabled
F 10.36 felguard:felstorm
G 0.00 wrathguard:wrathstorm
H 0.00 run_action_list,name=aoe,if=active_enemies>4
I 1.00 summon_doomguard
J 0.00 metamorphosis,if=buff.perfect_aim.react&active_enemies>1
K 4.55 doom,cycle_targets=1,if=buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
L 0.49 touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
M 3.26 soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
N 2.32 doom,cycle_targets=1,if=buff.metamorphosis.up&(ticks_remain<=1|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react&dot.doom.crit_pct<100
O 15.88 touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<20&dot.corruption.crit_pct<100
P 18.19 cancel_metamorphosis,if=buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
Q 66.66 soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
R 100.83 touch_of_chaos,if=buff.metamorphosis.up
S 3.84 corruption,cycle_targets=1,if=buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
T 1.66 hand_of_guldan,if=buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
U 1.29 corruption,cycle_targets=1,if=!ticking&target.time_to_die>=6&miss_react
V 20.71 metamorphosis,if=(buff.dark_soul.up&demonic_fury%32>buff.dark_soul.remains)|(dot.corruption.remains<5&dot.corruption.crit_pct<100)|!dot.doom.ticking|demonic_fury>=950|demonic_fury%32>target.time_to_die|buff.perfect_aim.react
W 24.53 hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time&(charges=2|dot.shadowflame.remains>travel_time|(charges=1&recharge_time<4))
X 54.39 soul_fire,if=buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
Y 7.16 life_tap,if=mana.pct<60
Z 65.40 shadow_bolt
a 0.00 fel_flame,moving=1
b 0.00 life_tap

Sample Sequence

ABDCFIUVNKRMROOQOQQQQQWVORXXSXXXZZWZZYWXZZZXZZZFVRRRRRRRRRRPZZWZZWXYZVQRRRRRRRRRPZZZXZWZFVQQQRQRPZZWZXXVRRRQRRRRRRADCERRRRRRRRRQQQQQFRRRPWZXZWSVKQPXZXXXZYZVQRRRRRRRRPWZZWXXXBZVRFQRRQRRRPZZXZWZZWVRRRRQQRQPXXYZZZZZZVRFRRQRRRRRRNPWADCEVNQQQRRQRRRRRRRRRQPWXXZSVKPXZWZFZWZZYZZXZZVRRMRRRRRPZZXWXZZWYVRQRRKRRRPZFZZZZXZVRRRRRRRRQPWZXXWXXXVQQQQQPXABDCEVOOQFOQ9QQOOQQQQOQQQOPWXXXWXXXXXXXXXXVOOOOOQOQPWFXXXSVKQQQQQQQCQQQRRWXXXVQQQRR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 155 148 80
Agility 167 159 80
Stamina 32894 29904 27081
Intellect 23928 21424 20220
Spirit 279 279 80
Health 606919 565059 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 38029 32068 10654
Spell Hit 15.01% 15.01% 4303
Spell Crit 20.11% 14.12% 2378
Spell Haste 41.98% 35.22% 14968
Spell Speed 41.98% 35.22% 14968
ManaReg per Second 4259 4057 0
Attack Power 308 266 0
Melee Hit 12.66% 12.66% 4303
Melee Crit 11.80% 6.79% 2378
Melee Haste 35.22% 35.22% 14968
Swing Speed 48.74% 35.22% 14968
Expertise 2.35% 2.35% 799
Armor 16276 16276 16276
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 25.50% 20.50% 7501

Gear

Source Slot Average Item Level: 540.20
Local Head hood_of_the_crimson_wake,id=96887,gems=sinister_primal_160hit_160mastery_180int
Local Neck megaeras_shining_eye,id=96825,reforge=crit_exp
Local Shoulders mantle_of_the_thousandfold_hells,id=96729,gems=80int_160haste_320haste_120haste,enchant=200int_100crit,reforge=crit_hit
Shirt empty
Local Chest starburner_robes,id=95039,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all
Local Waist cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_mastery
Local Legs leggings_of_the_discarded_warning,id=95030,gems=80int_160mastery_320haste_320haste_180mastery,enchant=285int_165crit
Local Feet damrens_frozen_footguards,id=96900,gems=80int_160mastery_60haste,enchant=140mastery
Local Wrists frostborn_wristwraps,id=96824,suffix=340,gems=320haste_60int,enchant=180int,reforge=haste_mastery
Local Hands gloves_of_the_thousandfold_hells,id=96725,gems=80int_160mastery_60int,enchant=170haste,reforge=crit_hit
Local Finger1 radens_summoning_band,id=95019,gems=160haste_160hit_60int,reforge=haste_exp
Local Finger2 roshaks_remembrance,id=96901,gems=160haste_160hit_60haste,reforge=crit_haste
Blizzard Trinket1 unerring_vision_of_leishen,id=96930
Local Trinket2 breath_of_the_hydra,id=96827
Local Back red_sky_cloudcloak,id=95014,gems=320haste_60haste,enchant=lightweave_embroidery_3,reforge=haste_exp
Local Main Hand suenwo_spire_of_the_falling_sun,id=96911,gems=80int_160mastery_320haste_60int,enchant=jade_spirit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Horror Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Felguard"
level=90
race=troll
role=spell
position=back
professions=herbalism=600/tailoring=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#VZ!....1.
talent_override=grimoire_of_sacrifice
talent_override=grimoire_of_service
talent_override=grimoire_of_service
talent_override=grimoire_of_service
talent_override=grimoire_of_service
talent_override=grimoire_of_supremacy
talent_override=grimoire_of_supremacy
talent_override=grimoire_of_supremacy
talent_override=grimoire_of_supremacy
talent_override=grimoire_of_service
glyphs=imp_swarm/everlasting_affliction
spec=demonology

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet,if=!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/service_pet,if=talent.grimoire_of_service.enabled
actions.precombat+=/jade_serpent_potion

# Executed every time the actor is available.

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/lifeblood
actions+=/berserking
actions+=/imp_swarm,if=buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/felguard:felstorm
actions+=/wrathguard:wrathstorm
actions+=/run_action_list,name=aoe,if=active_enemies>4
actions+=/summon_doomguard
actions+=/metamorphosis,if=buff.perfect_aim.react&active_enemies>1
actions+=/doom,cycle_targets=1,if=buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
actions+=/touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
actions+=/soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
actions+=/doom,cycle_targets=1,if=buff.metamorphosis.up&(ticks_remain<=1|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react&dot.doom.crit_pct<100
actions+=/touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<20&dot.corruption.crit_pct<100
actions+=/cancel_metamorphosis,if=buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
actions+=/soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
actions+=/touch_of_chaos,if=buff.metamorphosis.up
actions+=/corruption,cycle_targets=1,if=buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
actions+=/hand_of_guldan,if=buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
actions+=/corruption,cycle_targets=1,if=!ticking&target.time_to_die>=6&miss_react
actions+=/metamorphosis,if=(buff.dark_soul.up&demonic_fury%32>buff.dark_soul.remains)|(dot.corruption.remains<5&dot.corruption.crit_pct<100)|!dot.doom.ticking|demonic_fury>=950|demonic_fury%32>target.time_to_die|buff.perfect_aim.react
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time&(charges=2|dot.shadowflame.remains>travel_time|(charges=1&recharge_time<4))
actions+=/soul_fire,if=buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
actions+=/life_tap,if=mana.pct<60
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_infernal
actions.aoe+=/cancel_metamorphosis,if=buff.metamorphosis.up&dot.corruption.remains>10&demonic_fury<=650&buff.dark_soul.down&!dot.immolation_aura.ticking
actions.aoe+=/immolation_aura,if=buff.metamorphosis.up
actions.aoe+=/void_ray,if=buff.metamorphosis.up&dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=buff.metamorphosis.up&(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
actions.aoe+=/void_ray,if=buff.metamorphosis.up
actions.aoe+=/corruption,cycle_targets=1,if=!ticking&target.time_to_die>30&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=dot.corruption.remains<10|buff.dark_soul.up|demonic_fury>=950|demonic_fury%32>target.time_to_die
actions.aoe+=/hellfire,chain=1,interrupt=1
actions.aoe+=/life_tap

head=hood_of_the_crimson_wake,id=96887,gems=sinister_primal_160hit_160mastery_180int
neck=megaeras_shining_eye,id=96825,reforge=crit_exp
shoulders=mantle_of_the_thousandfold_hells,id=96729,gems=80int_160haste_320haste_120haste,enchant=200int_100crit,reforge=crit_hit
back=red_sky_cloudcloak,id=95014,gems=320haste_60haste,enchant=lightweave_embroidery_3,reforge=haste_exp
chest=starburner_robes,id=95039,gems=80int_160haste_80int_160haste_80int_160haste_180int,enchant=80all
wrists=frostborn_wristwraps,id=96824,suffix=340,gems=320haste_60int,enchant=180int,reforge=haste_mastery
hands=gloves_of_the_thousandfold_hells,id=96725,gems=80int_160mastery_60int,enchant=170haste,reforge=crit_hit
waist=cord_of_cacophonous_cawing,id=96834,gems=80int_160haste_320haste_320haste_120haste,reforge=hit_mastery
legs=leggings_of_the_discarded_warning,id=95030,gems=80int_160mastery_320haste_320haste_180mastery,enchant=285int_165crit
feet=damrens_frozen_footguards,id=96900,gems=80int_160mastery_60haste,enchant=140mastery
finger1=radens_summoning_band,id=95019,gems=160haste_160hit_60int,reforge=haste_exp
finger2=roshaks_remembrance,id=96901,gems=160haste_160hit_60haste,reforge=crit_haste
trinket1=unerring_vision_of_leishen,id=96930
trinket2=breath_of_the_hydra,id=96827
main_hand=suenwo_spire_of_the_falling_sun,id=96911,gems=80int_160mastery_320haste_60int,enchant=jade_spirit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=27081
# gear_intellect=20220
# gear_spirit=80
# gear_spell_power=10654
# gear_expertise_rating=799
# gear_hit_rating=4303
# gear_crit_rating=2378
# gear_haste_rating=14968
# gear_mastery_rating=7501
# gear_armor=16276
# meta_gem=sinister_primal
# tier15_2pc_caster=1
# back=red_sky_cloudcloak,heroic=1,enchant=lightweave_embroidery_3
# trinket1=unerring_vision_of_leishen,heroic=1
# main_hand=suenwo_spire_of_the_falling_sun,heroic=1,weapon=staff_3.30speed_8970min_13455max,enchant=jade_spirit
default_pet=felguard

Felhunter : 224685 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
224684.9 224684.9 371.34 / 0.17% 15310 / 6.8% 24.2 6238.4 5863.8 Mana 0.00% 55.0 100.0% 100%
Talents http://us.battle.net/wow/en/tool/talent-calculator#VZ!....1.
Glyphs
  • Glyph of Imp Swarm
  • Glyph of Everlasting Affliction
Professions
  • herbalism: 600
  • tailoring: 600

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Felhunter Damage Per Execute Time&chts=dddddd,18&chs=550x270&chd=t:1637572|1293081|711371|186524|170359|92890|88742|59835&chds=0,3275143&chco=C79C6E,9482C9,9482C9,C41F3B,9482C9,74FB0A,C41F3B,9482C9&chm=t++1637572++imp_swarm,C79C6E,0,0,15|t++1293081++doom,9482C9,1,0,15|t++711371++service_felhunter,9482C9,2,0,15|t++186524++soul_fire_meta,C41F3B,3,0,15|t++170359++hand_of_guldan,9482C9,4,0,15|t++92890++touch_of_chaos,74FB0A,5,0,15|t++88742++soul_fire,C41F3B,6,0,15|t++59835++shadow_bolt,9482C9,7,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Felhunter Damage Sources&chts=dddddd,18&chs=550x275&chd=t:25,23,17,14,13,10,9,5,5,4,4,3,2,2,2,0&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,74FB0A,9482C9,C79C6E,C41F3B,9482C9,AC5102,9482C9,9482C9,C79C6E,336600,9482C9,9482C9,9482C9,336600&chl=soul_fire_meta|wild_imp: firebolt|touch_of_chaos|doom|felhunter: melee|soul_fire|shadow_bolt|shadowflame|felhunter: shadow_bite|corruption|service_felhunter: melee|stormlash|doomguard: doom_bolt|service_felhunter: shadow_bite|hand_of_guldan|felhunter: stormlash&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Felhunter DPS Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:vyz1233444455678741yvtpoliffcaYWWXXWVVUUWUUUTTUUTTTSSTSSSSRSSRRRRSSRRRRRSSRRRRSSRRRRRSRRRRRSSRRSSRTRRRSRSSRRRRRSRRSTUVWXYZaaccdefgiiiiihgfedbaZYXWVUTSRQPOOOOONNNNNNNNMMMMMMNNNNNNNOOOOPPPPPPPPPPPPPPPPPOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPPQRSTTUVWXYZabcdeeffffedcbaZYXWVUTSSRQPOOOOOOOOOONNNNNNNNNNOOOOOPPPPQQQQQQQQQRRRRRRRRQQQQQQQQQQQQPPPPPPPPPPPPPQPQQQQQQQRRSTUVWYZbcdfghijklmmmmlkjihfecbaZXWVUTSRRQQQQQQQQQQQQQQQQQQQQQQQQRRRRRRRRRRRRRRRRRRRRRRRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTTUUVWWXYZZabccdeeffffeedcbaaZYXWVVTTSRQQQPPPPPPPPPPPPPPPPQQQQQQRRRRSSSSSSSSSSTSSSSSSSSSRRRRRR&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3535,0.4&chxt=x,y&chxl=0:|0|sec=569|1:|0|avg=224685|max=635550&chxp=1,1,35,100& http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Felhunter DPS Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,1,7,10,16,17,29,20,47,64,72,79,92,103,98,119,125,122,126,132,115,119,130,115,121,82,72,81,76,59,52,48,31,21,16,20,10,10,15,8,8,1,3,1,1,1,0,1,1&chds=0,132&chbh=5&chxt=x&chxl=0:|min=198224|avg=224685|max=260978&chxp=0,1,42,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Felhunter Spent Time&chts=dddddd,18&chs=550x275&chd=t:27.3,23.5,16.6,6.2,1.6,1.6,1.2,1.1,0.8,0.2&chds=0,100&chdls=ffffff&chco=74FB0A,9482C9,C41F3B,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,C79C6E&chl=touch_of_chaos 123.0s|shadow_bolt 106.1s|soul_fire 75.0s|hand_of_guldan 28.1s|life_tap 7.4s|doom 7.1s|corruption 5.4s|imp_swarm 4.8s|service_felhunter 3.5s|summon_doomguard 1.0s&

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Felhunter 224685
berserking 0 0.0% 3.0 180.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 3.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
cancel_metamorphosis 0 0.0% 18.5 21.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.47 18.47 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
corruption 6696 3.0% 5.0 90.25sec 599791 563092 0 0 0 0.0% 0.0% 0.0% 0.0% 361.3 5741 13053 8343 35.6% 0.0% 99.2%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.03 5.03 361.34 361.34 1.0653 1.2381 3014796.61 3014796.61 0.00 6659.33 563092.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 232.7 64.41% 5740.71 4926 11165 5744.78 5315 6268 1336046 1336046 0.00
crit 128.6 35.59% 13052.95 9852 27739 13023.67 11135 16899 1678751 1678751 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over {$d=18 seconds}.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.150000
  • base_td:160.23
  • num_ticks:14
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 4.3 120.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 4.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by {$s1=18000}.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${{$113861m1=30}} for {$113861d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your Mastery by ${{$113861m1=30}/{$56228m1=10}}. This effect is disabled while on cooldown.][]
doom 20590 9.1% 6.9 66.42sec 1340196 1293081 0 0 0 0.0% 0.0% 0.0% 0.0% 52.9 68889 177830 174494 96.9% 0.0% 98.0%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.89 6.89 52.92 52.92 1.0365 8.3551 9233890.41 9233890.41 0.00 20553.83 1293080.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.6 3.06% 68889.04 54342 123802 33420.78 0 123802 111672 111672 0.00
crit 51.3 96.94% 177830.47 108685 297125 178440.11 141319 229808 9122218 9122218 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=15}/2000}.2][{$t1=15}] sec.
  • description:Inflicts impending doom upon the target, causing $o3 Shadow damage over {$d=60 seconds}. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.937500
  • base_td:1001.44
  • num_ticks:6
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
firebolt 17647 7.8% 230.2 1.97sec 34373 20490 25354 54796 34306 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 230.20 230.66 0.00 0.00 1.6776 0.0000 7912745.90 7912745.90 0.00 20490.05 20490.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.52 69.59% 25353.53 17775 33230 25401.24 22165 29413 4069800 4069800 0.00
crit 70.13 30.41% 54796.18 35550 66460 54928.81 47803 62395 3842946 3842946 0.00
DPS Timeline Chart
hand_of_guldan 2452 (10592) 1.1% (4.7%) 26.1 16.62sec 183553 170359 33316 69713 42636 25.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.05 25.96 0.00 0.00 1.0775 0.0000 1106976.51 1106976.51 0.00 170359.23 170359.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.32 74.40% 33316.03 29624 55382 33323.84 30188 37053 643537 643537 0.00
crit 6.65 25.60% 69712.74 59248 132916 69691.81 0 132916 463439 463439 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for {$86040s1=6740} Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 {$@spelldesc47960=Reduces movement speed by {$47960s2=30}% and deals $47960o1 Shadowflame damage over {$47960d=6 seconds}. Generates 2 Demonic Fury every time it deals damage.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.575000
  • base_dd_min:614.22
  • base_dd_max:614.22
imp_swarm 0 (17647) 0.0% (7.8%) 4.7 110.73sec 1697189 1637572 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: imp_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 4.66 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 1637571.59 1637571.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: imp_swarm

Static Values
  • id:104316
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.52
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
Spelldata
  • id:104316
  • name:Imp Swarm
  • school:physical
  • tooltip:
  • description:Summons {$104316s1=5} $104316lWild Imp:Wild Imps; from the Twisting Nether to attack the target. The Wild Imps passive effect is disabled while Imp Swarm is on cooldown. Imp Swarm's cooldown is reduced by spell haste. Also increases Wild Imp's cooldown by {$s3=4} sec.
life_tap 0 0.0% 6.9 61.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 1.0731 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<60
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:{$?s63320=false}[Places a stacking heal absorb effect on you for {$d=0 milliseconds} equal to {$m3=15}% of your total health and restores][Restores] ${{$m1=15}*$MHP*0.01} mana.{$?s63320=false}[ Lasts {$d=0 milliseconds}.][]
lifeblood 0 0.0% 4.3 120.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lifeblood

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 4.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lifeblood

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
metamorphosis 0 0.0% 20.6 22.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.61 20.61 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 20.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${{$104315m1=0}*{$m3=300}/100+{$77219m1=0}*{$m3=300}/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
service_felhunter 0 (5468) 0.0% (2.4%) 4.3 120.75sec 568586 711371 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: service_felhunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.7994 0.0000 0.00 0.00 0.00 711370.79 711370.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: service_felhunter

Static Values
  • id:111897
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_service.enabled
Spelldata
  • id:111897
  • name:Grimoire: Felhunter
  • school:shadow
  • tooltip:
  • description:Summons a Felhunter who attacks the target for {$108501s1=20} sec. Felhunters will Spell Lock their target when summoned.
shadow_bolt 14072 6.3% 65.1 4.93sec 97520 59835 78927 163551 97518 22.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.07 65.07 0.00 0.00 1.6298 0.0000 6345766.81 6345766.81 0.00 59834.68 59834.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.78 78.03% 78927.33 71098 128406 78936.69 73694 89906 4007634 4007634 0.00
crit 14.30 21.97% 163550.53 142196 308174 163674.50 144983 197001 2338133 2338133 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s3=16177} Shadow damage.$?a104315[ Generates {$s2=25} Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.380000
  • base_dd_min:1474.12
  • base_dd_max:1474.12
shadowflame 8140 3.6% 26.0 16.60sec 141532 0 0 0 0 26.6% 0.0% 0.0% 0.0% 234.6 11988 25705 15663 26.8% 0.0% 33.8%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.96 25.96 234.61 234.61 0.0000 0.6499 3674666.30 3674666.30 0.00 24101.70 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.05 73.38% 0.00 0 0 0.00 0 0 0 0 0.00
crit 6.91 26.62% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.8 73.21% 11987.77 7058 41508 11984.85 9976 14353 2059061 2059061 0.00
crit 62.9 26.79% 25704.65 14116 99619 25618.10 19457 36798 1615605 1615605 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every {$t1=1} sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by {$47960s2=30}% and deals $47960o1 Shadowflame damage over {$47960d=6 seconds}. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 14764 6.6% 52.9 7.96sec 125730 88742 0 126490 126490 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.92 52.60 0.00 0.00 1.4168 0.0000 6653221.20 6653221.20 0.00 88741.56 88741.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 52.60 100.00% 126489.79 105690 345843 126549.69 111598 150443 6653221 6653221 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burn the enemy's soul, causing {$s1=9920 to 10102} Fire damage.{$?s108869=false}&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates {$s2=30} Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.854000
  • base_dd_min:821.02
  • base_dd_max:1003.47
soul_fire_meta 37111 16.5% 70.5 6.32sec 236856 186524 0 238590 238590 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire_meta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.52 70.01 0.00 0.00 1.2699 0.0000 16703763.87 16703763.87 0.00 186523.78 186523.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 70.01 100.00% 238589.95 148640 768834 238880.06 185875 302605 16703764 16703764 0.00
DPS Timeline Chart

Action details: soul_fire_meta

Static Values
  • id:104027
  • school:fire
  • resource:demonic_fury
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:160.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
Spelldata
  • id:104027
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:{$@spelldesc6353=Burn the enemy's soul, causing {$s1=9920 to 10102} Fire damage.{$?s108869=false}&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates {$s2=30} Demonic Fury.][]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.854000
  • base_dd_min:821.02
  • base_dd_max:1003.47
stormlash 4323 1.9% 29.4 11.27sec 64605 0 46107 110707 64607 28.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.36 29.36 0.00 0.00 0.0000 0.0000 1896767.98 1896767.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.95 71.37% 46107.48 15034 129667 46054.70 27156 70485 966099 966099 0.00
crit 8.41 28.63% 110706.99 30068 311200 111181.04 0 259922 930669 930669 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:14593.26
  • base_dd_max:14593.26
touch_of_chaos 25357 11.3% 118.6 3.72sec 96280 92890 72800 165183 96330 25.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.63 118.57 0.00 0.00 1.0365 0.0000 11421925.43 11421925.43 0.00 92889.88 92889.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.37 74.53% 72800.09 55574 126609 72874.68 64385 85068 6433412 6433412 0.00
crit 30.20 25.47% 165182.97 111148 303860 165621.91 133087 214446 4988513 4988513 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:
  • description:Unleashes energy at the enemy, causing {$s1=8950 to 9032} Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.767000
  • base_dd_min:778.35
  • base_dd_max:860.28
pet - felhunter 27961 / 27961
melee 19992 8.9% 351.8 1.28sec 25589 19991 21075 45473 25589 23.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 351.85 351.85 0.00 0.00 1.2800 0.0000 9003514.68 9003514.68 0.00 19990.93 19990.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 184.74 52.51% 21075.18 17802 32982 21084.61 19711 22809 3893489 3893489 0.00
crit 82.69 23.50% 45473.15 35603 79156 45517.90 40775 50855 3760316 3760316 0.00
glance 84.41 23.99% 15989.04 13351 24736 15998.91 14801 17498 1349710 1349710 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_bite 7264 3.2% 108.4 4.21sec 30165 29102 23321 50624 30165 25.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.42 108.42 0.00 0.00 1.0365 0.0000 3270325.10 3270325.10 0.00 29102.15 29102.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.24 74.94% 23320.77 19578 36601 23332.15 21916 25146 1894631 1894631 0.00
crit 27.17 25.06% 50624.49 39156 87841 50717.29 44631 60850 1375694 1375694 0.00
DPS Timeline Chart

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54049
  • name:Shadow Bite
  • school:shadow
  • tooltip:
  • description:Bite the enemy, causing {$s1=4454} Shadow damage.$?a104315[ Master gains {$s3=12} Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.380000
  • base_dd_min:405.92
  • base_dd_max:405.92
stormlash 706 0.3% 44.4 7.36sec 7023 0 4627 12483 7023 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.43 44.43 0.00 0.00 0.0000 0.0000 312069.15 312069.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.88 69.49% 4626.61 2158 13240 4622.06 3160 5941 142857 142857 0.00
crit 13.55 30.51% 12483.09 4317 31776 12610.47 6736 22886 169212 169212 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2095.44
  • base_dd_max:2095.44
pet - doomguard 23371 / 3169
doom_bolt 23371 1.4% 17.0 3.40sec 82486 24261 60089 133862 82488 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 3.4000 0.0000 1402259.15 1402259.15 0.00 24260.54 24260.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.84 69.64% 60088.53 46368 86684 60083.78 47159 73117 711392 711392 0.00
crit 5.16 30.36% 133862.49 92736 173369 135521.17 105778 173369 690867 690867 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=10502 to 10598} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - wild_imp 41727 / 34444
firebolt 41727 15.3% 591.0 0.75sec 26239 14349 21005 43052 28645 24.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 591.03 586.96 0.00 0.00 1.8286 0.0000 15508164.71 15508164.71 0.00 14349.31 14349.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 442.77 75.43% 21005.03 17775 33230 21011.71 19741 29413 9300466 9300466 0.00
crit 144.19 24.57% 43052.46 35550 66460 43065.06 39797 62395 6207699 6207699 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=4035 to 4053} Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.345000
  • base_dd_min:359.32
  • base_dd_max:377.74
pet - service_felhunter 39190 / 7957
melee 26932 2.4% 76.6 5.53sec 32076 27222 25776 54362 32075 27.1% 0.0% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.58 76.58 0.00 0.00 1.1783 0.0000 2456363.35 2456363.35 0.00 27221.85 27221.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.62 49.12% 25776.25 17802 32982 25817.30 22876 29637 969592 969592 0.00
crit 20.74 27.08% 54362.18 35603 65963 54445.40 45745 62627 1127341 1127341 0.00
glance 18.22 23.80% 19722.58 13351 24736 19755.77 17033 23020 359431 359431 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_bite 12258 1.1% 30.4 14.68sec 36758 35462 28053 59377 36757 27.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.42 30.42 0.00 0.00 1.0366 0.0000 1118110.07 1118110.07 0.00 35461.78 35461.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.96 72.21% 28052.53 19578 36601 28070.45 24700 31964 616125 616125 0.00
crit 8.45 27.79% 59377.13 39156 73201 59626.16 49556 73201 501985 501985 0.00
DPS Timeline Chart

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54049
  • name:Shadow Bite
  • school:shadow
  • tooltip:
  • description:Bite the enemy, causing {$s1=4454} Shadow damage.$?a104315[ Master gains {$s3=12} Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.380000
  • base_dd_min:405.92
  • base_dd_max:405.92

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 6.68% 7.80%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserking_1:6.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.04% 11.43%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
breath_of_the_hydra 5.9 1.9 79.7sec 57.7sec 29.81% 29.81%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_breath_of_the_hydra
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:8753.00

    Stack Uptimes

    • breath_of_the_hydra_1:29.81%

    Trigger Attempt Success

    • trigger_pct:99.93%
dark_soul 4.3 0.0 120.8sec 120.8sec 18.60% 31.90%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:18.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by {$s1=18000}.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${{$113861m1=30}} for {$113861d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your Mastery by ${{$113861m1=30}/{$56228m1=10}}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 8.8 0.0 49.1sec 44.1sec 2.95% 2.88%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • demonic_calling_1:2.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,{$?s114168=false}[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,{$?s114168=false}[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
jade_serpent_potion 2.0 0.0 363.8sec 0.0sec 10.17% 10.17%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.03

    Stack Uptimes

    • jade_serpent_potion_1:10.17%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105702
  • name:Potion of the Jade Serpent
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:60.00
  • default_chance:0.00%
jade_spirit 14.7 12.8 31.4sec 16.4sec 53.86% 53.86%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:53.86%

    Trigger Attempt Success

    • trigger_pct:99.58%
lifeblood 4.3 0.0 120.8sec 120.8sec 18.61% 18.61%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_lifeblood
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:2880.00

    Stack Uptimes

    • lifeblood_1:18.61%

    Trigger Attempt Success

    • trigger_pct:100.00%
lightweave_embroidery_3 8.1 0.0 58.7sec 58.7sec 26.58% 26.58%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:2000.00

    Stack Uptimes

    • lightweave_embroidery_3_1:26.58%

    Trigger Attempt Success

    • trigger_pct:99.94%
metamorphosis 20.6 0.0 22.3sec 22.3sec 50.29% 65.96%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • metamorphosis_1:50.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${{$104315m1=0}*{$m3=300}/100+{$77219m1=0}*{$m3=300}/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
molten_core 36.8 96.0 9.4sec 3.4sec 54.71% 100.00%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_molten_core
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • molten_core_1:22.84%
  • molten_core_2:7.87%
  • molten_core_3:3.02%
  • molten_core_4:1.79%
  • molten_core_5:1.45%
  • molten_core_6:1.36%
  • molten_core_7:1.32%
  • molten_core_8:1.29%
  • molten_core_9:3.05%
  • molten_core_10:10.73%

Trigger Attempt Success

  • trigger_pct:91.66%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants {$s3=0} additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by {$122355s1=50}%. $?({$m3=0}>0)[Soul Fire grants {$s3=0} additional Demonic Fury. ][] Lasts {$d=30 seconds}.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
perfect_aim 8.3 0.5 55.2sec 51.6sec 7.56% 7.56%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_perfect_aim
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • perfect_aim_1:7.56%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:138963
  • name:Perfect Aim
  • tooltip:Critical strike chance increased by {$s1=100}%.
  • description:Critical strike chance increased by {$s1=100}% for {$d=4 seconds}.
  • max_stacks:
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
skull_banner 5.8 0.0 76.0sec 76.0sec 12.79% 15.01%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.04% 9.04%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tempus_repit 8.1 2.1 57.0sec 44.3sec 20.02% 22.38%

Buff details

  • buff initial source:Felhunter
  • cooldown name:buff_tempus_repit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tempus_repit_1:20.02%

Trigger Attempt Success

  • trigger_pct:99.81%

Spelldata details

  • id:137590
  • name:Tempus Repit
  • tooltip:{$s1=30}% increased spellcasting speed.
  • description:Increases your haste by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
felhunter-skull_banner 5.8 0.0 76.0sec 76.0sec 12.79% 22.45%

Buff details

  • buff initial source:Felhunter_felhunter
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
felhunter-stormlash 4.0 0.0 103.7sec 103.7sec 9.04% 9.04%

Buff details

  • buff initial source:Felhunter_felhunter
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
attack_speed

Buff details

  • buff initial source:
  • cooldown name:buff_attack_speed
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_speed_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Felhunter
corruption Mana 5.0 18850.5 3750.0 3750.3 159.9
dark_soul Mana 4.3 64968.0 15000.0 14999.5 0.0
doom Demonic Fury 6.9 356.5 51.7 51.7 25899.2
firebolt Energy 230.2 230.2 1.0 1.0 34372.2
hand_of_guldan Mana 26.1 390762.0 15000.0 15000.2 12.2
shadow_bolt Mana 65.1 1073608.8 16500.0 16499.0 5.9
soul_fire Mana 52.9 1190709.0 22500.0 22501.5 5.6
soul_fire_meta Demonic Fury 70.5 4969.4 70.5 70.5 3361.3
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 0.0
touch_of_chaos Demonic Fury 118.6 4333.4 36.5 36.5 2635.8
pet - felhunter
shadow_bite Energy 108.4 6504.9 60.0 60.0 502.7
pet - doomguard
doom_bolt Energy 17.0 595.0 35.0 35.0 2356.7
pet - wild_imp
firebolt Energy 821.2 821.2 1.0 1.0 26239.3
pet - service_felhunter
shadow_bite Energy 30.4 1825.1 60.0 60.0 612.6
Resource Gains Type Count Total Average Overflow
felhunter Demonic Fury 108.42 1295.71 (13.48%) 11.95 5.28 0.41%
wild_imp Demonic Fury 821.24 4077.28 (42.42%) 4.96 28.91 0.70%
service_felhunter Demonic Fury 30.42 359.13 (3.74%) 11.81 5.88 1.61%
metamorphosis Demonic Fury 217.24 -1303.23 (-13.56%) -6.00 -0.23 0.02%
soul_fire Demonic Fury 52.92 1584.43 (16.48%) 29.94 3.18 0.20%
corruption Demonic Fury 366.37 1459.66 (15.19%) 3.98 5.83 0.40%
shadowflame Demonic Fury 258.53 513.86 (5.35%) 1.99 3.19 0.62%
life_tap Mana 6.87 625648.52 (23.65%) 91037.85 0.00 0.00%
shadow_bolt Demonic Fury 65.07 1624.75 (16.90%) 24.97 1.93 0.12%
mp5_regen Mana 1803.76 2019285.92 (76.35%) 1119.49 124122.81 5.79%
pet - felhunter
energy_regen Energy 1803.76 6405.22 (100.00%) 3.55 0.00 0.00%
pet - doomguard
energy_regen Energy 240.00 590.42 (100.00%) 2.46 426.96 41.97%
pet - service_felhunter
energy_regen Energy 365.21 1409.29 (100.00%) 3.86 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 1387.06
Mana 5863.79 6238.38
Demonic Fury 24.20 24.30
Combat End Resource Mean Min Max
Health -18688.44 -394497.35 242767.60
Mana 131039.81 17171.97 263595.60
Demonic Fury 152.45 0.00 891.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.2%
felhunter-Mana Cap 5.2%
succubus-Mana Cap 5.2%
infernal-Mana Cap 5.2%
observer-Mana Cap 5.2%
shivarra-Mana Cap 5.2%
abyssal-Mana Cap 5.2%
felguard-Mana Cap 5.2%
service_felguard-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
wild_imp-Mana Cap 5.2%
service_felhunter-Mana Cap 5.2%
service_succubus-Mana Cap 5.2%

Procs

Count Interval
wild_imp 60.1 7.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 2499
Mean 451.06
Minimum 347.21
Maximum 569.98
Spread ( max - min ) 222.77
Range [ ( max - min ) / 2 * 100% ] 24.69%
Distribution Chart

DPS

Sample Data Felhunter Damage Per Second
Count 2499
Mean 224684.86
Minimum 198224.24
Maximum 260977.73
Spread ( max - min ) 62753.49
Range [ ( max - min ) / 2 * 100% ] 13.96%
Standard Deviation 9471.2482
5th Percentile 209984.15
95th Percentile 240604.96
( 95th Percentile - 5th Percentile ) 30620.81
Mean Distribution
Standard Deviation 189.4629
95.00% Confidence Intervall ( 224313.52 - 225056.20 )
Normalized 95.00% Confidence Intervall ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6825
0.1 Scale Factor Error with Delta=300 765769
0.05 Scale Factor Error with Delta=300 3063078
0.01 Scale Factor Error with Delta=300 76576957
Distribution Chart

DPS(e)

Sample Data
Count 2499
Mean 224684.86
Distribution Chart

Damage

Sample Data
Count 2499
Mean 67964521.03
Distribution Chart

DTPS

Sample Data Felhunter Damage Taken Per Second
Count 2499
Mean 0.00
Distribution Chart

HPS

Sample Data Felhunter Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 2499
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 2499
Mean 0.00
Distribution Chart

HTPS

Sample Data Felhunter Healing taken Per Second
Count 2499
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 2499
Mean 413.40
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet,if=!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down
4 0.00 snapshot_stats
5 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
6 0.00 service_pet,if=talent.grimoire_of_service.enabled
7 0.00 jade_serpent_potion
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
A 4.33 lifeblood
B 3.04 berserking
C 4.66 imp_swarm,if=buff.dark_soul.up|(cooldown.dark_soul.remains>(120%(1%spell_haste)))|time_to_die<32
D 4.33 dark_soul
E 3.32 service_pet,if=talent.grimoire_of_service.enabled
F 0.00 felguard:felstorm
G 0.00 wrathguard:wrathstorm
H 0.00 run_action_list,name=aoe,if=active_enemies>4
I 1.00 summon_doomguard
J 0.00 metamorphosis,if=buff.perfect_aim.react&active_enemies>1
K 4.57 doom,cycle_targets=1,if=buff.metamorphosis.up&buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
L 0.50 touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<1.5
M 3.26 soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.perfect_aim.react&buff.perfect_aim.remains>cast_time)
N 2.32 doom,cycle_targets=1,if=buff.metamorphosis.up&(ticks_remain<=1|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react&dot.doom.crit_pct<100
O 15.84 touch_of_chaos,cycle_targets=1,if=buff.metamorphosis.up&dot.corruption.ticking&dot.corruption.remains<20&dot.corruption.crit_pct<100
P 18.47 cancel_metamorphosis,if=buff.metamorphosis.up&buff.dark_soul.down&demonic_fury<=650&target.time_to_die>30
Q 67.59 soul_fire,if=buff.metamorphosis.up&buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
R 102.29 touch_of_chaos,if=buff.metamorphosis.up
S 3.74 corruption,cycle_targets=1,if=buff.perfect_aim.react&(crit_pct<100|ticks_remain<=add_ticks)
T 1.60 hand_of_guldan,if=buff.perfect_aim.react&buff.perfect_aim.remains>travel_time
U 1.29 corruption,cycle_targets=1,if=!ticking&target.time_to_die>=6&miss_react
V 20.61 metamorphosis,if=(buff.dark_soul.up&demonic_fury%32>buff.dark_soul.remains)|(dot.corruption.remains<5&dot.corruption.crit_pct<100)|!dot.doom.ticking|demonic_fury>=950|demonic_fury%32>target.time_to_die|buff.perfect_aim.react
W 24.45 hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time&(charges=2|dot.shadowflame.remains>travel_time|(charges=1&recharge_time<4))
X 53.25 soul_fire,if=buff.molten_core.react&(buff.dark_soul.remains<action.shadow_bolt.cast_time|buff.dark_soul.remains>cast_time)
Y 6.87 life_tap,if=mana.pct<60
Z 65.07 shadow_bolt
a 0.00 fel_flame,moving=1
b 0.00 life_tap

Sample Sequence

ABDCIUVNKRRRRRRRRMMQQQRRPWXXZWZZZXZZYZZZZZZZZVORRRRRRRRRPWZZXWXXYZVRQRRRQRRRPZZZZWZZVRQQQRRQPWZZZWXXZVRQRKRRQRRRPZADCEVQRRQQRRRRRRRRRQQPWXXZWZXZZVQRRRRRRRRPZZWXZZWYXVRRRBRKMRRRPZZZZZZZVRRRRRRQRPWZZWXXZZVQRRRRQRRRPZXZWZXYSTVKADCEQQQMQQRRRRQQQQQPZWXZZWZZVRRRQRRRRRPZZZXZSTVRR