close

SimulationCraft 504-11 (r14032)

for World of Warcraft 5.0.4 Live (build level 16016)

Beta Release

Table of Contents

Raid Summary

 

DPS Chart

Hunter_BM_T14H : 102509 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
102508.8 102508.8 73.46 / 0.07% 3103 / 3.0% 3941.7 11.5 11.4 Focus 0.00% 54.2 100.0%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Ya!...120

Charts

http://6.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:670538|358278|217888|109970|108800|95231|42460|18087|12956&chds=0,1341076&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,ABD473,C79C6E&chm=t++670538++stampede,C79C6E,0,0,15|t++358278++lynx_rush,C79C6E,1,0,15|t++217888++dire_beast,C79C6E,2,0,15|t++109970++kill_shot,C79C6E,3,0,15|t++108800++kill_command,C79C6E,4,0,15|t++95231++glaive_toss,C79C6E,5,0,15|t++42460++arcane_shot,69CCF0,6,0,15|t++18087++cobra_shot,ABD473,7,0,15|t++12956++ranged,C79C6E,8,0,15&chtt=Hunter_BM_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:35,31,28,28,24,17,15,14,12,8,7,1,1,1,1,1,1,1,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat: kill_command|cat: melee|ranged|arcane_shot|cat: claw|dire_beast: dire_beast_melee|cobra_shot|glaive_toss|cat: lynx_rush|kill_shot|serpent_sting|wolf: melee|hyena: melee|devilsaur: melee|raptor: melee|wolf: claw|devilsaur: claw|raptor: claw|hyena: claw&chtt=Hunter_BM_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:4756555544456755zwurpollihgecdaZYYYYYXZbcdddeefeeffffffffeecbaZZYYXXXXXXXWWWWWWWWWXWWXXXXXXWWVVVVVUUUVVVVVVVWWWXXYYYZaaaaaaZZZZZZZZaabaaaaZZZZZZZZZZZZZYXWWVVVVVVVVVVWWWXXXXYYZZZaaaaaaaaZYYXXWWVVVUUUUUUUUUUUUUUVVVVWWWWVVWXYYZZZZaabbbbcccdddeddcccccbbbaaaZZZYYYYXXXXWWWWWWWWWWWWWWWWVVVVVVVVVVVVWWXXYYZabbbccddeeffghhhgffeedccccbbbbaaaZZYYYZZaaaabbbbbbbbbbbbbbbbbbbcccccccccccbbaaZZYYYXXXXXXWWWWWWWXXXXYYZabcccccccccccdddddeeedddddeffgghhiijjjjjjjjjjiiihhggfffeeeeeddddcccccccccccccccccbcccbcbbbbbbbbbcccccdddddddddeeeeeeedddddcccccbcbbbaaZZZZYYXWWWWVVVUUT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=553|1:|0|avg=102509|max=224791&chxp=1,1,46,100&chtt=Hunter_BM_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,8,4,10,6,20,20,36,52,38,42,82,106,104,122,154,144,148,132,118,124,128,106,104,96,86,100,86,66,50,44,26,18,28,24,14,22,6,4,4,4,2,0,4,4,0,0,0,2&chds=0,154&chbh=5&chxt=x&chxl=0:|min=97164|avg=102509|max=110035&chxp=0,1,42,100&chtt=Hunter_BM_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.7,29.8,14.7,6.7,3.6,3.4,2.2,1.5,0.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,ABD473&chl=cobra_shot 165.3s|arcane_shot 134.3s|kill_command 66.3s|glaive_toss 30.4s|dire_beast 16.1s|kill_shot 15.4s|focus_fire 10.0s|lynx_rush 6.6s|serpent_sting 3.5s|stampede 2.1s|aspect_of_the_hawk 1.0s&chtt=Hunter_BM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_BM_T14H 102509
arcane_shot 12661 12.4% 129.6 3.42sec 44011 42460 33593 69823 44085 29.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.58 129.36 0.00 0.00 1.0365 0.0000 5702733.02 5702733.02 0.00 42459.80 42459.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.90 71.04% 33593.07 31200 40193 33592.84 33058 34282 3087150 3087150 0.00
crit 37.46 28.96% 69823.36 64272 82797 69837.03 67217 72411 2615583 2615583 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 8.4 56.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.40 8.40 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus>60&!buff.beast_within.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
blood_fury 0 0.0% 4.3 120.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 4.28 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 6635 6.5% 111.4 3.84sec 26832 18087 20673 42752 26870 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.45 111.29 0.00 0.00 1.4835 0.0000 2990316.30 2990316.30 0.00 18086.96 18086.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.06 71.93% 20673.10 20060 26177 20672.67 20359 20973 1654989 1654989 0.00
crit 31.23 28.07% 42751.81 41324 53925 42751.08 41741 44147 1335327 1335327 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (7761) 0.0% (7.6%) 15.5 29.38sec 225822 217888 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.49 15.49 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 217887.85 217887.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&focus<=80
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
focus_fire 0 0.0% 9.6 44.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.62 9.62 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82692
  • name:Focus Fire
  • school:physical
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
glaive_toss 6415 6.3% 29.3 15.54sec 98714 95231 38075 79122 49633 28.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.29 58.26 0.00 0.00 1.0366 0.0000 2891676.77 2891676.77 0.00 95230.59 95230.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.86 71.84% 38074.86 34811 54094 38082.37 36598 39592 1593692 1593692 0.00
crit 16.40 28.16% 79122.28 71710 111433 79169.77 72667 86709 1297985 1297985 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_command 0 (16007) 0.0% (15.6%) 63.9 7.02sec 112767 108800 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.93 63.93 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 108799.92 108799.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 63.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:Give the command to kill, causing your pet to instantly inflict $ damage to its target. The pet must be within 25 yards of the target to Kill Command.
  • description:Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target$?s53243[ and apply the Hunter's Mark effect][]. The pet must be within 25 yards of the target to Kill Command.
kill_shot 3758 3.7% 14.9 5.50sec 113985 109970 87262 180999 115161 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 14.72 0.00 0.00 1.0365 0.0000 1695634.15 1695634.15 0.00 109970.44 109970.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.34 70.24% 87261.73 80976 105666 87248.63 80976 92434 902426 902426 0.00
crit 4.38 29.76% 180998.59 166811 217671 180027.58 0 206268 793208 793208 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (5235) 0.0% (5.1%) 6.4 75.34sec 371327 358278 0 0 0 0.0% 0.0% 0.0% 0.0% 56.9 0 0 0 11.6% 0.0% 5.6%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.35 6.35 56.87 56.87 1.0364 0.4441 0.00 0.00 0.00 74088.10 358278.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.3 88.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 6.6 11.63% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 12888 12.6% 212.0 2.11sec 27404 12956 20978 43553 27404 28.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 211.97 211.97 0.00 0.00 2.1151 0.0000 5808777.79 5808777.79 0.00 12956.42 12956.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.64 71.54% 20977.80 19852 26070 20978.14 20676 21208 3180973 3180973 0.00
crit 60.34 28.46% 43553.43 40896 53705 43558.21 42456 44827 2627805 2627805 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.0 106.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.03 4.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up&!buff.beast_within.up
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.6 389.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.58 1.58 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 2981 2.9% 3.4 111.72sec 397916 383928 0 0 0 0.0% 0.0% 0.0% 0.0% 147.7 6992 14504 9094 28.0% 0.0% 98.3%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 3.37 147.72 147.72 1.0364 3.0000 1343365.31 1343365.31 0.00 3007.56 383928.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.4 72.02% 6992.33 6577 9583 6992.05 6850 7143 743944 743944 0.00
crit 41.3 27.98% 14504.27 13548 19742 14505.74 13947 15281 599421 599421 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (3134) 0.0% (3.0%) 2.0 300.73sec 695013 670538 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 670537.87 670537.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 46276 / 46276
claw 10994 10.7% 130.0 3.48sec 38062 24772 24238 48862 38062 56.3% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.01 130.01 0.00 0.00 1.5365 0.0000 4948251.59 4948251.59 0.00 24771.98 24771.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.43 43.40% 24237.75 16058 69175 24259.77 20083 29518 1367688 1367688 0.00
crit 73.24 56.34% 48862.11 32117 138350 48908.57 42041 56489 3578739 3578739 0.00
block 0.06 0.05% 28869.07 16058 69175 1754.68 0 69175 1825 1825 0.00
parry 0.27 0.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
kill_command 16007 15.6% 63.9 7.02sec 112767 0 80840 164874 112767 38.3% 0.3% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.93 63.93 0.00 0.00 0.0000 0.0000 7208756.43 7208756.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.21 61.33% 80839.84 70144 150896 80875.49 74491 88605 3169633 3169633 0.00
crit 24.46 38.26% 164873.81 140288 301792 165088.55 148499 192721 4032286 4032286 0.00
block 0.08 0.12% 86329.45 70144 150896 6638.70 0 150896 6837 6837 0.00
parry 0.18 0.28% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc34026
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:697.93
  • base_dd_max:697.93
lynx_rush 5235 5.1% 56.9 7.29sec 41484 0 30337 62446 41484 38.2% 3.7% 0.0% 1.5% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.87 56.87 0.00 0.00 0.0000 0.0000 2359261.60 2359261.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.22 56.66% 30337.45 25429 54196 30423.42 26494 35578 977521 977521 0.00
crit 21.71 38.18% 62446.11 50857 108392 62644.74 50857 78332 1355780 1355780 0.00
block 0.84 1.48% 30758.76 25429 54196 16925.76 0 54196 25960 25960 0.00
parry 2.10 3.68% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 14040 13.7% 322.0 1.40sec 19625 14044 14553 29957 19625 38.5% 0.2% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 322.02 322.02 0.00 0.00 1.3974 0.0000 6319676.35 6319676.35 0.00 14043.60 14043.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.12 37.30% 14553.32 12714 27098 14560.96 13941 15378 1748192 1748192 0.00
crit 124.05 38.52% 29957.10 25429 54196 29984.60 28336 32300 3716238 3716238 0.00
glance 77.05 23.93% 11076.69 9536 20324 11083.39 10360 12103 853464 853464 0.00
block 0.12 0.04% 14956.32 12714 27098 1703.29 0 27098 1783 1783 0.00
parry 0.68 0.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 5.8 84.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.84 5.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 8684 / 783
claw 3953 0.3% 13.0 26.62sec 12194 7921 8685 17123 12194 41.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.97 12.97 0.00 0.00 1.5394 0.0000 158106.94 158106.94 0.00 7921.19 7921.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.57 58.42% 8684.82 5003 14411 8712.75 5638 12453 65782 65782 0.00
crit 5.39 41.58% 17122.52 10006 28823 17074.69 0 25883 92325 92325 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4732 0.4% 29.2 11.28sec 6472 4888 4591 9577 6472 42.9% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 1.3242 0.0000 189267.54 189267.54 0.00 4887.73 4887.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.64 32.97% 4590.75 3943 5645 4590.14 3943 5503 44259 44259 0.00
crit 12.55 42.92% 9577.04 7885 11291 9579.92 8453 10910 120203 120203 0.00
glance 7.05 24.11% 3518.33 2957 4234 3520.25 2957 4234 24806 24806 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 8.0 45.58sec 0 0 0 0 0 41.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.72 58.94% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.28 41.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:5.60
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 300.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 8672 / 782
claw 3940 0.3% 13.0 26.63sec 12161 7901 8708 17065 12161 41.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.96 12.96 0.00 0.00 1.5392 0.0000 157601.90 157601.90 0.00 7900.64 7900.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.61 58.69% 8708.06 5003 14411 8731.60 5638 13310 66230 66230 0.00
crit 5.35 41.31% 17064.82 10006 28823 17053.47 10006 26620 91372 91372 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4732 0.4% 29.2 11.28sec 6472 4888 4582 9586 6472 42.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 1.3240 0.0000 189267.51 189267.51 0.00 4888.11 4888.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.68 33.10% 4582.11 3943 5645 4580.41 3943 5385 44355 44355 0.00
crit 12.53 42.85% 9585.56 7885 11291 9582.65 8311 10723 120134 120134 0.00
glance 7.03 24.05% 3523.72 2957 4234 3523.58 0 4234 24779 24779 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 8672 / 782
cackling_howl 0 0.0% 2.0 300.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:63.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3940 0.3% 13.0 26.62sec 12158 7899 8704 17073 12158 41.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.96 12.96 0.00 0.00 1.5393 0.0000 157600.48 157600.48 0.00 7898.59 7898.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.61 58.72% 8703.77 5003 14411 8716.65 5777 11890 66253 66253 0.00
crit 5.35 41.28% 17073.00 10006 28823 17047.48 10006 28823 91347 91347 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4732 0.4% 29.2 11.28sec 6473 4889 4577 9589 6473 42.8% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 1.3239 0.0000 189281.83 189281.83 0.00 4889.49 4889.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.72 33.26% 4576.81 3943 5645 4574.07 3943 5328 44509 44509 0.00
crit 12.53 42.85% 9588.78 7885 11291 9588.64 8350 10910 120144 120144 0.00
glance 6.99 23.89% 3524.96 2957 4234 3523.22 0 4234 24630 24630 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 8722 / 787
claw 3968 0.3% 13.0 26.61sec 12239 7951 8686 17122 12239 42.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.97 12.97 0.00 0.00 1.5392 0.0000 158721.43 158721.43 0.00 7951.18 7951.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.51 57.89% 8686.21 5003 14411 8696.21 5491 12453 65209 65209 0.00
crit 5.46 42.11% 17121.79 10006 28823 17106.67 0 26075 93512 93512 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4754 0.4% 29.2 11.27sec 6502 4912 4579 9592 6502 43.4% 0.0% 23.6% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.25 29.25 0.00 0.00 1.3238 0.0000 190177.37 190177.37 0.00 4911.61 4911.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.66 33.02% 4578.83 3943 5645 4574.48 3943 5487 44221 44221 0.00
crit 12.68 43.36% 9591.68 7885 11291 9593.40 8376 10742 121638 121638 0.00
glance 6.91 23.63% 3519.19 2957 4234 3516.25 2957 4234 24319 24319 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 16689 / 7761
dire_beast_melee 16689 7.6% 141.6 3.10sec 24706 14866 19945 40568 24706 28.8% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.57 141.57 0.00 0.00 1.6619 0.0000 3497535.71 3497535.71 0.00 14866.30 14866.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.72 47.13% 19945.26 18918 26183 19950.29 19316 20804 1330668 1330668 0.00
crit 40.76 28.79% 40567.85 37836 52367 40585.65 38485 43216 1653546 1653546 0.00
glance 34.09 24.08% 15057.33 14188 19638 15061.12 14436 16192 513323 513323 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 8.4 0.0 56.9sec 56.9sec 29.22% 28.29%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_beast_within
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • beast_within_1:29.2%

Spelldata details

  • id:34471
  • name:The Beast Within
  • tooltip:Enraged.
  • description:When your pet is under the effects of Bestial Wrath, you also go into a rage causing $34471s2% additional damage and reducing Focus costs of all your shots and abilities by $34471s1% for $19574d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.3 0.0 120.7sec 120.7sec 13.98% 13.98%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.96%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
cobra_strikes 15.1 4.3 28.7sec 22.1sec 24.01% 29.71%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_cobra_strikes
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • cobra_strikes_1:12.2%
  • cobra_strikes_2:8.4%
  • cobra_strikes_3:2.3%
  • cobra_strikes_4:0.8%
  • cobra_strikes_5:0.2%
  • cobra_strikes_6:0.1%

Spelldata details

  • id:53257
  • name:Cobra Strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • description:$@spelldesc53260
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
focus_fire 9.4 0.3 45.8sec 44.4sec 41.54% 38.68%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_focus_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • focus_fire_1:41.5%

Spelldata details

  • id:82692
  • name:Focus Fire
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 15.2 11.9 29.2sec 16.0sec 46.04% 44.84%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:46.0%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
rapid_fire 4.0 0.0 106.4sec 106.4sec 13.00% 11.46%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:13.0%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 6.7 0.0 70.2sec 70.2sec 21.93% 21.93%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:21.9%
terror_in_the_mists 4.5 0.0 110.8sec 110.8sec 19.65% 19.65%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:19.7%
virmens_bite_potion 2.0 0.0 398.8sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-bestial_wrath 6.9 0.0 70.5sec 70.5sec 23.99% 24.06%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:16.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bestial_wrath_1:24.0%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
  • max_stacks:
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
cat-frenzy_effect 11.1 40.8 41.7sec 8.6sec 81.48% 82.96%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:20.2%
  • frenzy_effect_2:20.6%
  • frenzy_effect_3:19.8%
  • frenzy_effect_4:19.4%
  • frenzy_effect_5:1.4%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
cat-rabid 3.2 0.0 169.2sec 169.3sec 14.06% 14.48%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:14.1%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-frenzy_effect 1.9 3.3 300.6sec 68.5sec 75.99% 73.74%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.1%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-frenzy_effect 1.9 3.3 300.5sec 68.9sec 76.60% 74.31%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-frenzy_effect 1.9 3.2 300.7sec 69.3sec 76.12% 73.88%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-frenzy_effect 1.9 3.3 300.5sec 69.1sec 76.89% 74.55%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.3%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
aspect_of_the_hawk

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_BM_T14H
arcane_shot Focus 129.6 2591.5 20.0 20.0 2200.5
glaive_toss Focus 29.3 370.6 12.7 12.7 7803.0
kill_command Focus 63.9 2157.4 33.7 33.7 3341.3
serpent_sting Focus 3.4 64.1 19.0 19.0 20960.6
pet - cat
claw Focus 130.0 4196.9 32.3 32.3 1179.0
pet - devilsaur
claw Focus 13.0 474.2 36.6 36.6 333.4
pet - raptor
claw Focus 13.0 474.0 36.6 36.6 332.5
pet - hyena
claw Focus 13.0 474.1 36.6 36.6 332.4
pet - wolf
claw Focus 13.0 474.2 36.6 36.6 334.7
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1802.29 2316.81 1.29 10.65 0.46%
invigoration Focus 27.34 536.25 19.62 10.52 1.92%
cobra_shot Focus 111.29 1556.38 13.98 1.67 0.11%
dire_beast Focus 141.57 707.16 5.00 0.68 0.10%
pet - cat
focus_regen Focus 1802.29 2909.28 1.61 0.05 0.00%
focus_fire Focus 9.62 288.70 30.00 0.00 0.00%
go_for_the_throat Focus 60.34 904.99 15.00 0.04 0.00%
pet - devilsaur
focus_regen Focus 159.99 252.84 1.58 0.25 0.10%
pet - raptor
focus_regen Focus 159.99 252.85 1.58 0.24 0.09%
pet - hyena
focus_regen Focus 159.99 252.85 1.58 0.24 0.09%
pet - wolf
focus_regen Focus 159.99 252.85 1.58 0.24 0.09%
Resource RPS-Gain RPS-Loss
Focus 11.35 11.50
Combat End Resource Mean Min Max
Health 460843.00 460843.00 460843.00
Focus 52.97 1.31 120.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.3%
cat-Focus Cap 0.3%
raptor-Focus Cap 0.3%
wolf-Focus Cap 0.3%
dire_beast-Focus Cap 0.3%

Procs

Count Interval
invigoration 27.3 16.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 2500
Mean 450.70
Minimum 350.64
Maximum 553.27
Spread ( max - min ) 202.63
Range [ ( max - min ) / 2 * 100% ] 22.48%

DPS

Sample Data
Count 2500
Mean 102508.82
Minimum 97163.83
Maximum 110035.26
Spread ( max - min ) 12871.43
Range [ ( max - min ) / 2 * 100% ] 6.28%
Standard Deviation 1874.0878
5th Percentile 99586.62
95th Percentile 105792.78
( 95th Percentile - 5th Percentile ) 6206.16
Mean Distribution
Standard Deviation 37.4818
95.00% Confidence Intervall ( 102435.35 - 102582.28 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1283
0.1 Scale Factor Error with Delta=300 29982
0.05 Scale Factor Error with Delta=300 119928
0.01 Scale Factor Error with Delta=300 2998220
Distribution Chart

DPS(e)

Sample Data
Count 2500
Mean 102508.82

Damage

Sample Data
Count 2500
Mean 20432503.36

DTPS

Sample Data
Count 2500
Mean 0.00

HPS

Sample Data
Count 2500
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 2500
Mean 0.00

Heal

Sample Data
Count 2500
Mean 0.00

HTPS

Sample Data
Count 2500
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 2500
Mean 407.47
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 1.00 aspect_of_the_hawk,moving=0
9 0.00 aspect_of_the_fox,moving=1
A 1.00 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 9.62 focus_fire,five_stacks=1
D 3.38 serpent_sting,if=!ticking
E 4.28 blood_fury
F 0.00 fervor,if=enabled&!ticking&focus<=65
G 8.40 bestial_wrath,if=focus>60&!buff.beast_within.up
H 0.00 multi_shot,if=target.adds>5
I 0.00 cobra_shot,if=target.adds>5
J 14.88 kill_shot
K 0.00 a_murder_of_crows,if=enabled&!ticking
L 2.00 stampede
M 29.29 glaive_toss,if=enabled
N 0.00 barrage,if=enabled
O 0.00 powershot,if=enabled
P 0.00 blink_strike,if=enabled
Q 6.35 lynx_rush,if=enabled&!ticking
R 4.03 rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
S 63.93 kill_command
T 15.49 dire_beast,if=enabled&focus<=80
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 1.58 readiness,wait_for_rapid_fire=1
W 129.58 arcane_shot,if=focus>=69|buff.beast_within.up
X 0.00 focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
Y 111.68 cobra_shot

Sample Sequence

8ADEGLMQSWWTWWSWWWWWDMSYWWWWSYYYWSYMYWWSTYWWWSCRVGMQSWTWWWSWWWWDSMRYYYWSYYYWWSYYMCWSTYYWWSYYWWMSYYWWYSYYWGWMSWWTWWYSWWYEWWYMSYYYCSYYQWWMSTYYWWSYYWWWSMYYYSYYCGWSWWMTWSWWYWWYSYYYMSWYYWSYWWYSMTYWWSYYWWSCYMYYSYWWQGWSWWYWMSTWYWEWYRYSYYWMCSYYWWYSYYWWWSMTYYYSYWWWWSCMYYYSYGWWWWSWYWMTLSWYWYSYYWMSYYQWSYYWWSMTYYSYYWWSYYMWSYYGWWCSWWJJTMESWYWWWYJJSYYMWSYYJJSWY7YWMSCJJTYSYWWWYJJMQSWGWWWWSJJWYWDMYSTJJRVGJMQSWTWWWSJJWWDS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22364 19934 18773
Stamina 22460 20418 20266
Intellect 191 182 80
Spirit 195 195 80
Health 460843 432255 0
Focus 120 120 0
Spell Power 0 0 0
Spell Hit 15.09% 15.09% 2575
Spell Crit 11.78% 6.78% 4056
Spell Haste 11.77% 6.45% 2741
Mana Per 5 0 0 0
Attack Power 49377 40028 0
Melee Hit 7.57% 7.57% 2575
Melee Crit 27.99% 21.06% 4056
Melee Haste 6.45% 6.45% 2741
Swing Speed 17.09% 6.45% 2741
Expertise 7.52% 7.52% 2556
Armor 25344 25344 25344
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 45.78% 35.78% 5933

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_BM_T14H"
origin="unknown"
level=90
race=orc
spec=beast_mastery
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Ya!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/focus_fire,five_stacks=1
actions+=/serpent_sting,if=!ticking
actions+=/blood_fury
actions+=/fervor,if=enabled&!ticking&focus<=65
actions+=/bestial_wrath,if=focus>60&!buff.beast_within.up
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/kill_shot
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/stampede
actions+=/glaive_toss,if=enabled
actions+=/barrage,if=enabled
actions+=/powershot,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/dire_beast,if=enabled&focus<=80
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=focus>=69|buff.beast_within.up
actions+=/focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
actions+=/cobra_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=exp_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_hit
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_hit
back=legbreaker_greatcloak,id=86963,enchant=180crit
chest=zorloks_fizzing_chestguard,id=87822,gems=160agi_80agi_160mastery_120agi,enchant=80all,reforge=mastery_crit
wrists=jagged_hornet_bracers,id=86997,enchant=180agi,reforge=hit_exp
hands=yaungol_slayers_gloves,id=87003,enchant=170mastery,reforge=hit_mastery
waist=fetters_of_death,id=87034,gems=320agi_320agi_160agi
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_mastery
finger1=painful_thorned_ring,id=86974,enchant=160agi
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=haste_crit

# Gear Summary
# gear_strength=80
# gear_agility=18773
# gear_stamina=20266
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2556
# gear_hit_rating=2575
# gear_crit_rating=4056
# gear_haste_rating=2741
# gear_mastery_rating=5933
# gear_armor=25344
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_MM_T14H : 99157 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
99156.7 99156.7 71.05 / 0.07% 3004 / 3.0% 5736.1 12.5 12.4 Focus 0.00% 57.5 100.0%
Talents http://us.battle.net/wow/en/tool/talent-calculator#YZ!...120

Charts

http://8.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:499825|262475|175411|108476|94965|94417|48576|40636|14226|11205&chds=0,999649&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,69CCF0,C79C6E,C79C6E&chm=t++499825++stampede,C79C6E,0,0,15|t++262475++lynx_rush,C79C6E,1,0,15|t++175411++dire_beast,C79C6E,2,0,15|t++108476++kill_shot,C79C6E,3,0,15|t++94965++glaive_toss,C79C6E,4,0,15|t++94417++chimera_shot,ABD473,5,0,15|t++48576++aimed_shot,C79C6E,6,0,15|t++40636++arcane_shot,69CCF0,7,0,15|t++14226++ranged,C79C6E,8,0,15|t++11205++steady_shot,C79C6E,9,0,15&chtt=Hunter_MM_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,14,13,13,12,9,9,8,8,6,6,6,5,5,4,0,0,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,69CCF0,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=ranged|arcane_shot|chimera_shot|cat: melee|wild_quiver_shot|glaive_toss|dire_beast: dire_beast_melee|aimed_shot|cat: claw|aimed_shot_mm|steady_shot|cat: lynx_rush|piercing_shots|kill_shot|serpent_sting|hyena: melee|devilsaur: melee|wolf: melee|raptor: melee|raptor: claw|wolf: claw|hyena: claw|devilsaur: claw&chtt=Hunter_MM_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:z100y0231345786543zyxtrrppnkjjgddbbaaaaaaaaaaaaaaZZZZYYYYYXYYYYYXXXXXXXXYYXYYYYYYXXXXXXXXYYYYYYYYYYYYYYYZZZZZZYXXXXXYXXYYYYYZZZZZZZZaaaaaaaaaaZZYYYXXXWWWWWWWWWWWWWWWWWWWXXXXXXXWXXXYYYYYYYYYYYYYYYYYZYYYYXYXXXXXXWWWWWWWWWWWWWWXXXYYYZZaabbbbbbbbbbaaaaaaaaZZZYYYYYYYYYYYYYYYYYZZYYYYYYYYYYYYYYYYYXXXXXYYYYYZZZZZZZZZZaaabbbbbaaaaaaaaabbaaaaZZZZZZZZZZZZZZZZZZaaaaaabbcdeeeeeeedddddddddddcbaaZZZZZZaaaaaZZZZZZabccdcccccddddeeffffeedcbbcccdddddddcbcccdddddeedddddddccccccbbbbbcbbbbbbbbbbcdddeedddcccddeeeffffeedddddddddddddcbaaZZZZZZZZYYYYYYYYYYYXXYYYZZZZZaaaaab&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=553|1:|0|avg=99157|max=217887&chxp=1,1,46,100&chtt=Hunter_MM_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,4,12,6,8,10,4,26,34,36,44,40,84,84,92,98,106,84,128,122,148,102,120,104,126,108,94,88,70,86,72,58,54,48,32,26,42,18,18,10,10,10,4,6,12,2,4,0,2&chds=0,148&chbh=5&chxt=x&chxl=0:|min=93996|avg=99157|max=105126&chxp=0,1,46,100&chtt=Hunter_MM_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:37.7,24.5,11.4,10.1,6.9,3.6,3.2,1.6,0.5,0.3,0.2&chds=0,100&chdls=ffffff&chco=C79C6E,69CCF0,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473&chl=steady_shot 170.1s|arcane_shot 110.2s|aimed_shot 51.6s|chimera_shot 45.6s|glaive_toss 31.2s|dire_beast 16.4s|kill_shot 14.3s|lynx_rush 7.1s|stampede 2.1s|serpent_sting 1.2s|aspect_of_the_hawk 1.0s&chtt=Hunter_MM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_MM_T14H 99157
aimed_shot 5560 5.6% 22.7 16.65sec 110275 48576 68993 150063 110361 51.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.72 22.70 0.00 0.00 2.2701 0.0000 2505717.36 2505717.36 0.00 48576.42 48576.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.12 48.97% 68993.15 68398 76184 68970.73 68398 71642 767149 767149 0.00
crit 11.59 51.03% 150062.90 140899 161611 150360.32 145844 157751 1738569 1738569 0.00
DPS Timeline Chart

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.master_marksman_fire.react
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6602.39
  • base_dd_max:7356.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
aimed_shot_mm 4229 4.3% 20.2 21.43sec 94449 0 69520 144159 94618 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.19 20.15 0.00 0.00 0.0000 0.0000 1906665.68 1906665.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.38 66.37% 69520.17 68398 78452 69518.88 68398 71191 929846 929846 0.00
crit 6.78 33.63% 144158.72 140899 161611 144214.68 140899 152373 976819 976819 0.00
DPS Timeline Chart

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:82928
  • name:Aimed Shot!
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6598.90
  • base_dd_max:7359.64
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
arcane_shot 9932 10.0% 106.3 3.60sec 42120 40636 31834 65750 42196 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.32 106.13 0.00 0.00 1.0365 0.0000 4478360.36 4478360.36 0.00 40635.53 40635.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.70 69.45% 31833.84 31163 36501 31835.29 31476 32170 2346281 2346281 0.00
crit 32.43 30.55% 65749.71 64195 75192 65756.29 64554 67298 2132079 2132079 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
blood_fury 0 0.0% 4.3 120.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
chimera_shot 9552 9.6% 44.0 9.76sec 97861 94417 73997 152829 98057 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.96 43.87 0.00 0.00 1.0365 0.0000 4301738.53 4301738.53 0.00 94417.12 94417.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.48 69.48% 73996.85 72436 85328 74002.45 72735 75015 2255424 2255424 0.00
crit 13.39 30.52% 152828.65 149217 175775 152856.90 149217 157662 2046315 2046315 0.00
DPS Timeline Chart

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:9.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=90
Spelldata
  • id:53209
  • name:Chimera Shot
  • school:nature
  • tooltip:(null)
  • description:An instant shot that causes $s3% ranged weapon Nature damage plus $<damage>, refreshing the duration of your Serpent Sting and healing you for $?s119447[${$53353m1+$119447m1}][$53353m1]% of your total health.$?s53243[ Applies the Hunter's Mark effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.10
dire_beast 0 (6400) 0.0% (6.4%) 15.8 29.14sec 181802 175411 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.83 15.83 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 175411.10 175411.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
glaive_toss 6577 6.6% 30.1 15.20sec 98430 94965 36950 76809 49463 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.08 59.86 0.00 0.00 1.0365 0.0000 2960927.48 2960927.48 0.00 94965.44 94965.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.07 68.61% 36950.44 34711 49074 36959.97 35702 38121 1517540 1517540 0.00
crit 18.79 31.39% 76808.63 71504 101093 76836.65 72665 83108 1443388 1443388 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3448 3.5% 13.8 5.88sec 112417 108476 84367 174484 113402 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.82 13.70 0.00 0.00 1.0363 0.0000 1553154.66 1553154.66 0.00 108475.67 108475.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.28 67.78% 84366.51 80871 95953 84407.86 80871 90538 783191 783191 0.00
crit 4.41 32.22% 174484.11 166594 197662 173458.00 0 190653 769963 769963 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4171) 0.0% (4.2%) 6.9 69.93sec 272041 262475 0 0 0 0.0% 0.0% 0.0% 0.0% 61.7 0 0 0 13.6% 0.0% 6.1%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.89 6.89 61.69 61.69 1.0364 0.4441 0.00 0.00 0.00 54285.25 262474.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.3 86.42% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.4 13.58% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
piercing_shots 3788 3.8% 76.2 5.75sec 22406 0 0 0 0 0.0% 0.0% 0.0% 0.0% 331.1 5154 0 5154 0.0% 0.0% 73.5%

Stats details: piercing_shots

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.16 76.16 331.08 331.08 0.0000 1.0000 1706467.42 1706467.42 0.00 5154.20 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 331.1 100.00% 5154.20 801 24921 5160.00 3607 6983 1706467 1706467 0.00
DPS Timeline Chart

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:63468
  • name:Piercing Shots
  • school:physical
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed for $53238s1% of the damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:800.73
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ranged 12766 12.9% 212.1 2.11sec 27118 14226 20343 42091 27118 31.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 212.13 212.13 0.00 0.00 1.9063 0.0000 5752692.47 5752692.47 0.00 14225.89 14225.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 146.05 68.85% 20343.14 19826 23673 20345.21 20166 20561 2971091 2971091 0.00
crit 66.09 31.15% 42090.89 40841 48766 42098.74 41474 42781 2781602 2781602 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.4 108.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.36 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up|target.time_to_die<=30
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.7 403.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.72 1.72 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 2841 2.9% 1.2 194.91sec 1091685 1053768 0 0 0 0.0% 0.0% 0.0% 0.0% 141.2 6819 14115 9069 30.8% 0.0% 94.0%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.17 1.17 141.17 141.17 1.0360 3.0000 1280328.24 1280328.24 0.00 3014.43 1053768.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.6 69.16% 6819.19 6562 8697 6820.04 6696 6962 665777 665777 0.00
crit 43.5 30.84% 14114.65 13517 17916 14116.83 13746 14668 614552 614552 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.health.pct<=90
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (2336) 0.0% (2.3%) 2.0 301.17sec 518068 499825 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 499824.54 499824.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
steady_shot 4227 4.3% 132.2 3.32sec 14411 11205 10559 22056 14432 33.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.24 132.04 0.00 0.00 1.2862 0.0000 1905717.52 1905717.52 0.00 11204.57 11204.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.56 66.31% 10559.01 10365 12161 10559.28 10458 10637 924521 924521 0.00
crit 44.49 33.69% 22055.70 21353 25051 22063.67 21772 22447 981196 981196 0.00
DPS Timeline Chart

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $m1. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1994.08
  • base_dd_max:1994.08
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
wild_quiver_shot 8731 8.8% 189.9 2.35sec 20725 0 15792 31736 20762 31.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.86 189.51 0.00 0.00 0.0000 0.0000 3934711.88 3934711.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.44 68.83% 15792.43 15402 18274 15793.70 15602 16013 2060003 2060003 0.00
crit 59.07 31.17% 31736.00 30803 36549 31740.81 31184 32465 1874709 1874709 0.00
DPS Timeline Chart

Action details: wild_quiver_shot

Static Values
  • id:76663
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:45.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:76663
  • name:Wild Quiver
  • school:physical
  • tooltip:(null)
  • description:Deals ranged weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
pet - cat 18768 / 18768
claw 5406 5.5% 128.2 3.53sec 18987 12358 13202 27213 18987 41.5% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.19 128.19 0.00 0.00 1.5365 0.0000 2433930.62 2433930.62 0.00 12357.68 12357.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.56 58.16% 13201.68 10982 39457 13208.40 12024 14330 984317 984317 0.00
crit 53.20 41.50% 27213.11 21963 78914 27250.66 24204 31061 1447824 1447824 0.00
block 0.11 0.09% 16323.07 10982 39457 1733.09 0 39457 1789 1789 0.00
parry 0.32 0.25% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4171 4.2% 61.7 6.85sec 30396 0 21814 45296 30396 40.1% 3.8% 0.0% 1.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.69 61.69 0.00 0.00 0.0000 0.0000 1875120.98 1875120.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.75 54.70% 21814.16 17391 30914 21837.62 19422 24852 736132 736132 0.00
crit 24.73 40.09% 45295.87 34782 61828 45333.92 38739 56372 1120149 1120149 0.00
block 0.86 1.40% 21785.67 17391 30914 12540.11 0 30914 18840 18840 0.00
parry 2.35 3.81% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9191 9.3% 313.2 1.44sec 13215 9197 9608 19736 13215 41.3% 0.2% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 313.17 313.17 0.00 0.00 1.4369 0.0000 4138672.24 4138672.24 0.00 9197.13 9197.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.39 34.29% 9608.44 8695 15457 9609.93 9193 10040 1031893 1031893 0.00
crit 129.40 41.32% 19736.22 17391 30914 19747.46 18940 20746 2553914 2553914 0.00
glance 75.50 24.11% 7304.42 6522 11593 7306.88 6918 7906 551519 551519 0.00
block 0.13 0.04% 10657.49 8695 15457 1265.14 0 15457 1347 1347 0.00
parry 0.75 0.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.3 120.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 6468 / 583
claw 3090 0.3% 14.0 24.72sec 8840 5744 5893 12493 8840 44.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 13.98 0.00 0.00 1.5391 0.0000 123614.22 123614.22 0.00 5743.62 5743.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.74 55.35% 5892.96 3421 9864 5879.89 3421 8353 45607 45607 0.00
crit 6.24 44.65% 12493.18 6842 19728 12515.86 6842 19728 78007 78007 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3378 0.3% 30.0 11.00sec 4504 3453 3097 6489 4504 46.5% 0.0% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.3045 0.0000 135117.91 135117.91 0.00 3452.61 3452.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.93 29.75% 3096.57 2696 3864 3094.86 2696 3709 27641 27641 0.00
crit 13.94 46.48% 6488.81 5393 7729 6490.06 5744 7467 90475 90475 0.00
glance 7.13 23.77% 2384.43 2022 2898 2382.73 0 2898 17002 17002 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 63.85sec 0 0 0 0 0 45.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.28 54.60% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.72 45.40% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 6481 / 585
claw 3120 0.3% 14.0 24.72sec 8924 5798 5861 12552 8924 45.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 13.98 0.00 0.00 1.5391 0.0000 124785.71 124785.71 0.00 5798.32 5798.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.58 54.22% 5860.51 3421 9864 5847.39 3547 8686 44432 44432 0.00
crit 6.40 45.78% 12552.12 6842 19728 12547.23 0 18884 80354 80354 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3361 0.3% 30.0 11.00sec 4481 3435 3095 6481 4481 46.0% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.3045 0.0000 134441.33 134441.33 0.00 3435.32 3435.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.95 29.85% 3095.45 2696 3864 3094.18 2696 3786 27718 27718 0.00
crit 13.79 45.96% 6481.21 5393 7729 6480.46 5711 7293 89363 89363 0.00
glance 7.26 24.19% 2392.04 2022 2898 2389.72 0 2898 17360 17360 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 6469 / 583
cackling_howl 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3090 0.3% 14.0 24.72sec 8842 5745 5866 12563 8842 44.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 13.98 0.00 0.00 1.5390 0.0000 123619.49 123619.49 0.00 5745.20 5745.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.77 55.57% 5865.98 3421 9864 5860.46 3421 8273 45576 45576 0.00
crit 6.21 44.43% 12563.29 6842 19728 12598.65 6842 19047 78043 78043 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3379 0.3% 30.0 11.00sec 4505 3454 3099 6477 4505 46.6% 0.0% 23.6% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.3045 0.0000 135160.03 135160.03 0.00 3453.69 3453.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.93 29.78% 3099.30 2696 3864 3095.53 2696 3626 27690 27690 0.00
crit 13.98 46.58% 6477.41 5393 7729 6477.76 5800 7114 90523 90523 0.00
glance 7.09 23.63% 2390.07 2022 2898 2388.58 2022 2898 16947 16947 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 6485 / 585
claw 3109 0.3% 14.0 24.72sec 8894 5779 5845 12601 8894 45.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 13.98 0.00 0.00 1.5390 0.0000 124361.07 124361.07 0.00 5778.86 5778.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.67 54.88% 5844.89 3421 9864 5830.19 3421 8173 44851 44851 0.00
crit 6.31 45.12% 12601.39 6842 19728 12641.39 6842 19728 79510 79510 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3376 0.3% 30.0 11.00sec 4501 3451 3098 6476 4501 46.5% 0.0% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.3045 0.0000 135036.51 135036.51 0.00 3450.53 3450.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.91 29.71% 3097.67 2696 3864 3094.13 2696 3670 27606 27606 0.00
crit 13.95 46.51% 6476.02 5393 7729 6480.19 5594 7433 90359 90359 0.00
glance 7.14 23.78% 2392.56 2022 2898 2389.79 0 2898 17071 17071 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 13264 / 6400
dire_beast_melee 13264 6.4% 161.9 2.75sec 17780 11443 13857 28401 17780 32.5% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.88 161.88 0.00 0.00 1.5538 0.0000 2878145.38 2878145.38 0.00 11442.74 11442.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.52 43.57% 13857.24 12942 17925 13862.90 13296 14552 977268 977268 0.00
crit 52.58 32.48% 28401.16 25884 35851 28419.77 26913 30058 1493469 1493469 0.00
glance 38.77 23.95% 10508.87 9707 13444 10515.88 9962 11320 407408 407408 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 120.7sec 120.7sec 14.02% 14.02%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.72%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 15.9 15.7 27.9sec 13.8sec 51.17% 50.40%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:51.2%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
master_marksman 21.0 40.9 21.1sec 7.1sec 56.33% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_1:28.4%
  • master_marksman_2:27.9%

Spelldata details

  • id:82925
  • name:Ready, Set, Aim...
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
master_marksman_fire 20.3 0.0 21.4sec 21.4sec 7.37% 6.20%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman_fire
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_fire_1:7.4%

Spelldata details

  • id:82926
  • name:Fire!
  • tooltip:Aimed Shot cast time and Focus cost reduced by $s1%.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
rapid_fire 4.4 0.0 108.4sec 108.4sec 14.10% 18.59%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:14.1%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 7.1 0.0 66.7sec 66.7sec 23.23% 23.23%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:23.2%
steady_focus 18.5 29.9 24.4sec 9.1sec 89.21% 86.65%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • steady_focus_1:89.2%

Spelldata details

  • id:53220
  • name:Steady Focus
  • tooltip:Ranged attack speed increased by $w1%. Steady Shot Focus generation increased by $w2.
  • description:$@spelldesc53224
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
terror_in_the_mists 4.5 0.0 109.7sec 109.7sec 19.81% 19.81%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:19.8%
virmens_bite_potion 2.0 0.0 398.8sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-rabid 4.3 0.0 120.6sec 120.7sec 18.63% 22.21%

Buff details

  • buff initial source:Hunter_MM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:18.6%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
aspect_of_the_hawk

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_MM_T14H
aimed_shot Focus 22.7 1043.5 45.9 45.9 2401.2
arcane_shot Focus 106.3 2126.5 20.0 20.0 2106.0
chimera_shot Focus 44.0 1978.1 45.0 45.0 2174.7
glaive_toss Focus 30.1 451.2 15.0 15.0 6562.0
serpent_sting Focus 1.2 29.3 25.0 25.0 43667.4
pet - cat
claw Focus 128.2 3433.7 26.8 26.8 708.8
pet - devilsaur
claw Focus 14.0 524.6 37.5 37.5 235.6
pet - raptor
claw Focus 14.0 524.6 37.5 37.5 237.9
pet - hyena
claw Focus 14.0 524.5 37.5 37.5 235.7
pet - wolf
claw Focus 14.0 524.6 37.5 37.5 237.1
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1802.29 2594.84 1.44 86.23 3.22%
rapid_recuperation Focus 256.46 63.39 0.25 8.42 11.73%
steady_shot Focus 132.04 1814.57 13.74 34.06 1.84%
steady_focus Focus 117.69 334.50 2.84 18.56 5.26%
dire_beast Focus 161.88 770.52 4.76 38.87 4.80%
pet - cat
focus_regen Focus 1802.29 3351.35 1.86 0.00 0.00%
pet - devilsaur
focus_regen Focus 159.99 348.40 2.18 0.26 0.07%
pet - raptor
focus_regen Focus 159.99 348.39 2.18 0.26 0.07%
pet - hyena
focus_regen Focus 159.99 348.40 2.18 0.26 0.07%
pet - wolf
focus_regen Focus 159.99 348.40 2.18 0.26 0.07%
Resource RPS-Gain RPS-Loss
Focus 12.38 12.49
Combat End Resource Mean Min Max
Health 461207.00 461207.00 461207.00
Focus 49.19 0.25 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.8%
cat-Focus Cap 0.8%
raptor-Focus Cap 0.8%
wolf-Focus Cap 0.8%
dire_beast-Focus Cap 0.8%

Procs

Count Interval
wild_quiver 189.9 2.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 2500
Mean 450.70
Minimum 350.64
Maximum 553.27
Spread ( max - min ) 202.63
Range [ ( max - min ) / 2 * 100% ] 22.48%

DPS

Sample Data
Count 2500
Mean 99156.71
Minimum 93995.66
Maximum 105126.25
Spread ( max - min ) 11130.59
Range [ ( max - min ) / 2 * 100% ] 5.61%
Standard Deviation 1812.5474
5th Percentile 96319.30
95th Percentile 102327.47
( 95th Percentile - 5th Percentile ) 6008.17
Mean Distribution
Standard Deviation 36.2509
95.00% Confidence Intervall ( 99085.66 - 99227.76 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1283
0.1 Scale Factor Error with Delta=300 28045
0.05 Scale Factor Error with Delta=300 112181
0.01 Scale Factor Error with Delta=300 2804545
Distribution Chart

DPS(e)

Sample Data
Count 2500
Mean 99156.71

Damage

Sample Data
Count 2500
Mean 32286481.60

DTPS

Sample Data
Count 2500
Mean 0.00

HPS

Sample Data
Count 2500
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 2500
Mean 0.00

Heal

Sample Data
Count 2500
Mean 0.00

HTPS

Sample Data
Count 2500
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 2500
Mean 431.60
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 1.00 aspect_of_the_hawk,moving=0
9 0.00 aspect_of_the_fox,moving=1
A 23.72 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 4.29 blood_fury
D 30.08 glaive_toss,if=enabled
E 0.00 powershot,if=enabled
F 0.00 barrage,if=enabled
G 0.00 blink_strike,if=enabled
H 6.89 lynx_rush,if=enabled&!ticking
I 0.00 multi_shot,if=target.adds>5
J 0.00 steady_shot,if=target.adds>5
K 1.17 serpent_sting,if=!ticking&target.health.pct<=90
L 43.96 chimera_shot,if=target.health.pct<=90
M 15.83 dire_beast,if=enabled
N 2.00 stampede
O 4.36 rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
P 1.72 readiness,wait_for_rapid_fire=1
Q 31.68 steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
R 13.82 kill_shot
S 17.49 aimed_shot,if=buff.master_marksman_fire.react
T 0.00 a_murder_of_crows,if=enabled&!ticking
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 25.45 aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
W 106.32 arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
X 0.00 fervor,if=enabled&focus<=50
Y 100.81 steady_shot

Sample Sequence

8ACDHMNOPDHMVAVAYQVAVAYYVAVAYDYVASVAVAYQYVASVADYMQVAVAYYVAKLOSVADYQVAYYLVAYYYVAWSDLMWWYQWWLWYWYDYQLSWWYYWWYHDLMWWYQWWLWWYYDYWLWYWCYQSWLWYDMYQWLWSWWYQYLDWWYYWWYLWWYQYDMLSWWYQWWWLWWYDYQYLSWWHYQWWLDMWYQYWLSWWYQWDWLWYYYWWYLWWSDMYOQVAYLVVAYYVAYDCVAYYLWSWYYYWLWDMYQSWWLWWYQYWDLWWYHQYWLWSWYDMYQLSWWYYWWWLDNWYQYWLWWYYYDMLWWWYQYSLWWWDYQYLWWWYYYWLDMWYQSWWLRRCWYQDWWHLWRRYQYWLWDMRRYQW7LSWWYRRDWLWYQYWRRLOPDHMLRRVAYQVAYLVYDORRVAVAYQLYYVARRDYMLSWWY

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22294 19867 18709
Stamina 22486 20442 20290
Intellect 191 182 80
Spirit 195 195 80
Health 461207 432591 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2551
Spell Crit 14.68% 9.68% 5797
Spell Haste 17.63% 12.03% 5111
Mana Per 5 0 0 0
Attack Power 49223 39894 0
Melee Hit 7.50% 7.50% 2551
Melee Crit 30.83% 23.91% 5797
Melee Haste 12.03% 12.03% 5111
Swing Speed 23.23% 12.03% 5111
Expertise 7.50% 7.50% 2550
Armor 25356 25356 25356
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 32.56% 22.56% 1965

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_MM_T14H"
origin="unknown"
level=90
race=orc
spec=marksmanship
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#YZ!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/blood_fury
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health.pct<=90
actions+=/chimera_shot,if=target.health.pct<=90
actions+=/dire_beast,if=enabled
actions+=/stampede
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
actions+=/fervor,if=enabled&focus<=50
actions+=/steady_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
chest=sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
wrists=stonemaw_armguards,id=87014,enchant=180agi
hands=yaungol_slayers_gloves,id=87003,enchant=170haste
waist=rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
finger1=painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=18709
# gear_stamina=20290
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2550
# gear_hit_rating=2551
# gear_crit_rating=5797
# gear_haste_rating=5111
# gear_mastery_rating=1965
# gear_armor=25356
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_SV_T14H : 99877 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
99876.9 99876.9 54.16 / 0.05% 2317 / 2.3% 7258.2 10.1 10.1 Focus 0.00% 53.6 100.0%
Talents http://us.battle.net/wow/en/tool/talent-calculator#Yb!...120

Charts

http://8.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:469380|261074|189196|175342|107894|94811|70876|47867|19958|12230&chds=0,938761&chco=C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C41F3B,69CCF0,ABD473,C79C6E&chm=t++469380++stampede,C79C6E,0,0,15|t++261074++lynx_rush,C79C6E,1,0,15|t++189196++black_arrow,9482C9,2,0,15|t++175342++dire_beast,C79C6E,3,0,15|t++107894++kill_shot,C79C6E,4,0,15|t++94811++glaive_toss,C79C6E,5,0,15|t++70876++explosive_shot,C41F3B,6,0,15|t++47867++arcane_shot,69CCF0,7,0,15|t++19958++cobra_shot,ABD473,8,0,15|t++12230++ranged,C79C6E,9,0,15&chtt=Hunter_SV_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:28,17,13,12,11,9,9,8,8,6,6,5,0,0,0,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,C79C6E,69CCF0,C79C6E,9482C9,ABD473,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473&chl=explosive_shot|ranged|arcane_shot|cat: melee|black_arrow|serpent_sting|glaive_toss|dire_beast: dire_beast_melee|cobra_shot|cat: claw|cat: lynx_rush|kill_shot|devilsaur: melee|hyena: melee|raptor: melee|wolf: melee|devilsaur: claw|hyena: claw|wolf: claw|raptor: claw|serpent_sting_burst&chtt=Hunter_SV_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:txy1113334456785675530xwtsromljhihgfeecdcdcbbbaaaaZZZZZYYXXXXXXXXYYYYXYXXXXYYYYZZZaaaaZZaabbcbbbaaaaaaaZaaaaaaaaaabbbbbbbbbabababbbbbbbaabbbbcbccbbbaaZZZZYYYYYXYYXYYYYYYYYYYYYYYZZZZZabaaaababbbbbbaaaaaaaZZZaaabbbbbcccccbbaaaaaZZZZZZZZaaaabbccdddcccbbbbbaaaaaZZZZZYZZZZZZaaabcbbbbbbbaabaaaaaaaaaYYYYYYZZZaabbbccccccddddedddddccbcbbbbccccccccdcddccdcccbbbbbbbbbccddfghhhiiiiiihghhhhhhhhgffffffgggghihhhhgggfffffeefeeeeeeeddddddcddddddddddeddeeeeeeeeddeeedeeeeeeffffgggggggggghghhhhhhhhhhiiiiiiiiihhhgggffeeedddddcccccccccbccccccccccccccbbaaaZZYYYYYXXXXWWV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=553|1:|0|avg=99877|max=203334&chxp=1,1,49,100&chtt=Hunter_SV_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,2,2,6,4,10,22,16,30,40,16,44,44,62,68,84,124,84,136,136,118,134,132,128,108,116,98,110,106,94,72,64,62,46,46,30,12,20,24,12,12,8,4,2,0,4,2,0,2&chds=0,136&chbh=5&chxt=x&chxl=0:|min=95585|avg=99877|max=104632&chxp=0,1,47,100&chtt=Hunter_SV_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.0,29.4,20.3,6.8,4.1,3.5,3.1,1.6,0.5,0.4,0.2&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,69CCF0,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473&chl=cobra_shot 135.2s|explosive_shot 132.6s|arcane_shot 91.7s|glaive_toss 30.5s|black_arrow 18.7s|dire_beast 15.9s|kill_shot 13.9s|lynx_rush 7.3s|stampede 2.1s|serpent_sting 2.0s|aspect_of_the_hawk 1.0s&chtt=Hunter_SV_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_SV_T14H 99877
arcane_shot 9735 9.8% 88.4 4.94sec 49613 47867 37077 76867 49728 31.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.43 88.22 0.00 0.00 1.0365 0.0000 4387229.80 4387229.80 0.00 47866.78 47866.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.17 68.20% 37076.87 36236 42444 37079.89 36661 37618 2231019 2231019 0.00
crit 28.05 31.80% 76866.96 74646 87434 76883.34 75187 78824 2156210 2156210 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 7833 7.8% 18.0 24.99sec 196105 189196 0 0 0 0.0% 0.0% 0.0% 0.0% 178.1 14785 30793 19826 31.5% 0.0% 79.0%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.00 18.00 178.06 178.06 1.0365 2.0000 3530205.17 3530205.17 0.00 9419.53 189195.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.0 68.51% 14784.69 13847 19899 14792.28 14206 15310 1803460 1803460 0.00
crit 56.1 31.49% 30792.51 28525 40993 30807.17 29516 32568 1726745 1726745 0.00
DPS Timeline Chart

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.time_to_die>=8
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over $3674d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.150000
  • base_td:186.94
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
blood_fury 0 0.0% 4.3 120.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 5984 6.0% 85.4 5.03sec 31601 19958 23759 49081 31650 31.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.40 85.27 0.00 0.00 1.5834 0.0000 2698856.30 2698856.30 0.00 19958.26 19958.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.70 68.84% 23759.12 23296 27641 23760.58 23489 24066 1394641 1394641 0.00
crit 26.57 31.16% 49080.83 47990 56941 49083.64 48260 50103 1304215 1304215 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (6211) 0.0% (6.2%) 15.4 29.83sec 181709 175342 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.38 15.38 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 175342.27 175342.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
explosive_shot 20856 20.9% 127.9 3.49sec 73465 70876 18525 38589 24855 31.5% 0.0% 0.0% 0.0% 221.4 21277 43016 28108 31.4% 0.0% 49.1%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.93 127.71 221.45 221.45 1.0365 1.0000 9398648.94 9398648.94 0.00 26545.96 70876.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.42 68.45% 18525.43 17448 25074 18529.66 18111 19006 1619493 1619493 0.00
crit 40.29 31.55% 38589.29 35943 51652 38604.71 36902 40736 1554716 1554716 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.9 68.58% 21277.46 17448 46707 21282.05 20082 22520 3231297 3231297 0.00
crit 69.6 31.42% 43016.30 34896 93414 43033.70 39841 46804 2993143 2993143 0.00
DPS Timeline Chart

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lock_and_load.react
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.234000
  • base_dd_min:145.82
  • base_dd_max:437.45

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:false
  • direct_power_mod:0.234000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:22213.05
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
glaive_toss 6426 6.4% 29.4 15.49sec 98273 94811 36928 76843 49393 31.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.44 58.57 0.00 0.00 1.0365 0.0000 2893161.62 2893161.62 0.00 94811.13 94811.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.28 68.77% 36928.20 34711 49074 36941.43 35732 38361 1487556 1487556 0.00
crit 18.29 31.23% 76842.62 71504 101093 76889.54 71981 82552 1405605 1405605 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3319 3.3% 13.4 6.07sec 111826 107894 84331 174333 113037 31.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.36 13.22 0.00 0.00 1.0364 0.0000 1494441.14 1494441.14 0.00 107894.10 107894.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 68.10% 84330.79 80871 95953 84372.72 80871 89003 759314 759314 0.00
crit 4.22 31.90% 174332.85 166594 197662 173139.30 0 197662 735127 735127 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4266) 0.0% (4.3%) 7.1 67.19sec 270644 261074 0 0 0 0.0% 0.0% 0.0% 0.0% 63.5 0 0 0 13.3% 0.0% 6.3%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.09 7.09 63.49 63.49 1.0367 0.4442 0.00 0.00 0.00 53956.79 261073.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.0 86.65% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.5 13.35% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 12188 12.2% 201.5 2.22sec 27248 12230 20388 42258 27248 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.50 201.50 0.00 0.00 2.2280 0.0000 5490486.41 5490486.41 0.00 12230.08 12230.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.29 68.63% 20387.97 19826 23673 20390.37 20214 20608 2819445 2819445 0.00
crit 63.21 31.37% 42257.97 40841 48766 42268.99 41594 43175 2671042 2671042 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.5 102.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.54 4.54 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.8 380.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.82 1.82 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 6975 (7187) 7.0% (7.2%) 2.0 105.60sec 1653683 1596277 0 0 0 0.0% 0.0% 0.0% 0.0% 147.8 15962 33157 21273 30.9% 0.0% 98.4%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 1.96 147.76 147.76 1.0360 3.0000 3143205.34 3143205.34 0.00 7269.82 1596277.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.1 69.12% 15962.49 15260 20226 15965.69 15637 16320 1630178 1630178 0.00
crit 45.6 30.88% 33157.15 31435 41665 33169.13 32141 34690 1513027 1513027 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:2
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
serpent_sting_burst 212 0.2% 2.0 105.60sec 48041 0 34827 72338 48041 35.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 1.96 0.00 0.00 0.0000 0.0000 94044.71 94044.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.27 64.77% 34826.88 29345 38894 29525.60 0 38894 44160 44160 0.00
crit 0.69 35.23% 72337.91 60450 80122 40850.57 0 80122 49884 49884 0.00
DPS Timeline Chart

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
stampede 0 (2195) 0.0% (2.2%) 2.0 301.91sec 486513 469380 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 469380.33 469380.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 17944 / 17944
claw 4488 4.5% 108.8 4.17sec 18556 12077 12912 26681 18556 41.2% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.84 108.84 0.00 0.00 1.5365 0.0000 2019515.40 2019515.40 0.00 12076.78 12076.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.69 58.52% 12912.49 10982 39457 12929.25 11884 14204 822360 822360 0.00
crit 44.81 41.17% 26680.86 21963 78914 26728.10 23858 30213 1195559 1195559 0.00
block 0.10 0.10% 15231.55 10982 39457 1431.36 0 39457 1596 1596 0.00
parry 0.23 0.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4266 4.3% 63.5 6.61sec 30210 0 21747 44996 30210 39.8% 3.6% 0.0% 1.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.49 63.49 0.00 0.00 0.0000 0.0000 1918109.83 1918109.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.14 55.35% 21747.03 17391 30914 21765.57 19297 24794 764208 764208 0.00
crit 25.25 39.77% 44996.35 34782 61828 45037.62 39766 54200 1136212 1136212 0.00
block 0.82 1.29% 21572.94 17391 30914 12137.55 0 30914 17690 17690 0.00
parry 2.28 3.59% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9191 9.2% 313.1 1.44sec 13215 9197 9598 19704 13215 41.5% 0.3% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 313.14 313.14 0.00 0.00 1.4369 0.0000 4138167.66 4138167.66 0.00 9196.93 9196.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.10 34.20% 9598.01 8695 15457 9599.71 9184 10047 1027978 1027978 0.00
crit 129.89 41.48% 19703.81 17391 30914 19715.15 18804 20724 2559320 2559320 0.00
glance 75.22 24.02% 7304.79 6522 11593 7307.54 6979 7786 549466 549466 0.00
block 0.13 0.04% 10896.83 8695 15457 1370.85 0 15457 1404 1404 0.00
parry 0.80 0.26% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.3 120.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 6096 / 550
claw 2785 0.2% 13.0 26.70sec 8569 5567 5655 12100 8569 45.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 111397.57 111397.57 0.00 5566.82 5566.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.12 54.79% 5655.02 3421 9864 5635.94 3421 8353 40277 40277 0.00
crit 5.88 45.21% 12100.22 6842 19728 12113.96 6842 19728 71120 71120 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3312 0.3% 30.0 11.03sec 4415 3445 3032 6350 4415 46.7% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 132461.21 132461.21 0.00 3444.76 3444.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.82 29.41% 3032.27 2696 3864 3033.25 2696 3647 26757 26757 0.00
crit 14.01 46.69% 6350.07 5393 7729 6350.11 5393 7107 88942 88942 0.00
glance 7.17 23.90% 2338.04 2022 2898 2335.50 2022 2898 16763 16763 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 63.71sec 0 0 0 0 0 44.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.32 55.35% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.68 44.65% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 301.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 6072 / 548
claw 2770 0.2% 13.0 26.70sec 8522 5536 5705 11983 8522 44.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5394 0.0000 110786.50 110786.50 0.00 5536.00 5536.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.17 55.13% 5705.31 3421 9864 5697.49 3421 8786 40891 40891 0.00
crit 5.83 44.87% 11983.16 6842 19728 11985.86 0 19728 69895 69895 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3303 0.3% 30.0 11.03sec 4403 3435 3034 6350 4403 46.4% 0.0% 24.4% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 132104.44 132104.44 0.00 3435.48 3435.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.77 29.23% 3033.94 2696 3864 3034.48 2696 3653 26602 26602 0.00
crit 13.93 46.42% 6350.11 5393 7729 6352.87 5393 7387 88434 88434 0.00
glance 7.31 24.35% 2336.39 2022 2898 2332.57 0 2898 17069 17069 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 6081 / 549
cackling_howl 0 0.0% 2.0 301.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 2778 0.2% 13.0 26.70sec 8548 5553 5678 12048 8548 45.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 111126.75 111126.75 0.00 5553.28 5553.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.14 54.94% 5678.08 3421 9864 5664.85 0 9864 40555 40555 0.00
crit 5.86 45.06% 12047.87 6842 19728 12097.38 6842 19728 70572 70572 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3303 0.3% 30.0 11.03sec 4404 3436 3041 6333 4404 46.6% 0.0% 24.3% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 132108.49 132108.49 0.00 3435.58 3435.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.75 29.16% 3040.94 2696 3864 3038.47 2696 3651 26600 26600 0.00
crit 13.97 46.55% 6332.69 5393 7729 6336.44 5686 7133 88440 88440 0.00
glance 7.29 24.29% 2342.32 2022 2898 2344.32 2022 2898 17069 17069 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 6076 / 548
claw 2775 0.2% 13.0 26.70sec 8538 5547 5710 11968 8538 45.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5392 0.0000 111000.18 111000.18 0.00 5547.24 5547.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.12 54.80% 5709.69 3421 9864 5695.36 3421 8856 40676 40676 0.00
crit 5.88 45.20% 11968.07 6842 19728 11973.82 6842 19728 70324 70324 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3301 0.3% 30.0 11.03sec 4401 3434 3040 6341 4401 46.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 132040.28 132040.28 0.00 3433.81 3433.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.91 29.69% 3040.32 2696 3864 3037.63 2696 3559 27076 27076 0.00
crit 13.90 46.33% 6341.07 5393 7729 6344.00 5486 7099 88141 88141 0.00
glance 7.19 23.98% 2338.42 2022 2898 2339.45 2022 2898 16824 16824 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 13350 / 6211
dire_beast_melee 13350 6.2% 157.5 2.81sec 17738 11400 13818 28287 17738 32.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.53 157.53 0.00 0.00 1.5559 0.0000 2794254.43 2794254.43 0.00 11400.19 11400.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.25 43.32% 13818.13 12942 17925 13822.14 13279 14479 9