close

SimulationCraft 801-01

for World of Warcraft 8.0.1 Live (wow build level 26095, git build e2a31bd)

Beta Release

Current simulator hotfixes

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

T22_Death_Knight_Blood : 9137 dps, 0 dtps, 67 hps (22 aps), 52.2k TMI, 61.0k ETMI

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR   HPS HPS(e) HPS Error HPS Range HPR   APS APS Error APS Range APR
9136.9 9136.9 5.3 / 0.058% 922.7 / 10.1% 1338.5       44.9 44.9 0.12 / 0.27% 17 / 38.9% 7.4       22.2 0.03 / 0.13% 4 / 16.3% 7.4
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max   Window Bin Size
0.0 0.00 / 0.00% 0 / 0.0%       52.2k 9 / 0.02% 50.2k 53.5k 1.6k / 3.0%       0.0% -0.0% 0.0%       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.0 6.0 Runic Power 13.12% 50.0 100.0% 100%
Talents
  • 15: Rune Strike (Blood Death Knight)
  • 30: Hemostasis (Blood Death Knight)
  • 45: Ossuary (Blood Death Knight)
  • 60: Anti-Magic Barrier (Blood Death Knight)
  • 90: Bloodworms (Blood Death Knight)
  • 100: Red Thirst (Blood Death Knight)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
T22_Death_Knight_Blood 9137
auto_attack_mh 2463 27.0% 125.2 2.40sec 5895 2468 Direct 125.2 4709 9416 5895 25.2% 3.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.23 125.23 0.00 0.00 2.3882 0.0000 738293.16 1065139.93 30.69 2468.49 2468.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.86 72.55% 4752.17 4174 5862 4753.46 4589 4967 431787 617291 30.05
hit (blocked) 2.82 2.25% 3326.77 2922 4103 3118.22 0 4009 9376 19149 47.81
crit 30.60 24.43% 9502.77 8347 11724 9505.07 9027 10151 290738 415645 30.05
crit (blocked) 0.96 0.77% 6657.55 5843 8207 4088.14 0 8207 6392 13055 31.33
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Blood Boil 1077 11.8% 56.2 5.34sec 5748 5305 Direct 56.2 4595 9182 5748 25.1% 0.0%  

Stats details: blood_boil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.20 56.20 0.00 0.00 1.0835 0.0000 322995.34 322995.34 0.00 5304.75 5304.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.07 74.86% 4594.54 4034 5667 4595.92 4418 4830 193299 193299 0.00
crit 14.13 25.14% 9181.83 8069 11335 9183.97 8313 10015 129696 129696 0.00
 
 

Action details: blood_boil

Static Values
  • id:50842
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:7.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
Spelldata
  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within $A1 yds.][ and infects all enemies within $A1 yds with Blood Plague. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A shadowy disease that drains $o1 health from the target over {$d=24 seconds}. }]
 
Blood Plague 392 4.3% 56.2 5.34sec 2090 0 Periodic 98.8 949 1897 1189 25.4% 0.0% 98.8%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.20 0.00 98.75 98.75 0.0000 3.0000 117444.03 117444.03 0.00 396.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.7 74.64% 948.73 837 1176 948.97 914 988 69930 69930 0.00
crit 25.0 25.36% 1897.08 1674 2352 1897.59 1778 2021 47514 47514 0.00
 
 

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining $w1 health from the target every $t1 sec.
  • description:A shadowy disease that drains $o1 health from the target over {$d=24 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.062244
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Death and Decay 375 4.1% 15.2 19.48sec 7424 6790 Direct 163.9 549 1097 687 25.3% 0.0%  

Stats details: death_and_decay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.17 163.86 0.00 0.00 1.0934 0.0000 112594.80 112594.80 0.00 6789.77 6789.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.47 74.74% 548.58 485 681 548.75 524 576 67184 67184 0.00
crit 41.39 25.26% 1097.13 969 1362 1097.47 1038 1172 45410 45410 0.00
 
 

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.death_and_decay>=3
Spelldata
  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing ${$52212m1*11} Shadow damage over {$d=10 seconds} to targets within the area. While you remain within the area, your $?c1[Heart Strike will hit up to $188290m3 additional targets.]?s207311[Clawing Shadows will hit all enemies near the target.][Scourge Strike will hit all enemies near the target.]
 
Death Strike 1804 19.7% 44.4 6.55sec 12170 11098 Direct 44.4 9712 19420 12170 25.3% 3.1%  

Stats details: death_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.42 44.42 0.00 0.00 1.0966 0.0000 540615.84 780025.10 30.69 11097.75 11097.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.17 72.41% 9802.09 7861 14576 9804.37 9277 10377 315306 450768 30.05
hit (blocked) 1.01 2.27% 6856.60 5502 9936 4370.28 0 9935 6922 14136 32.53
crit 10.90 24.54% 19600.57 15721 29152 19604.98 17225 25319 213640 305425 30.05
crit (blocked) 0.35 0.78% 13724.69 11005 19873 3999.63 0 19873 4748 9697 14.88
 
 

Action details: death_strike

Static Values
  • id:49998
  • school:physical
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power.deficit<=10
Spelldata
  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heart Strike 935 10.2% 87.1 3.39sec 3218 2955 Direct 87.1 2566 5131 3217 25.4% 3.0%  

Stats details: heart_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.07 87.07 0.00 0.00 1.0889 0.0000 280157.82 404132.17 30.68 2954.81 2954.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.00 72.36% 2589.17 2278 3200 2589.85 2483 2742 163130 233214 30.05
hit (blocked) 1.95 2.24% 1811.62 1595 2240 1549.85 0 2240 3526 7202 43.66
crit 21.47 24.65% 5176.80 4556 6401 5178.05 4840 5552 111131 158875 30.05
crit (blocked) 0.65 0.75% 3620.46 3189 4480 1724.00 0 4480 2370 4841 24.28
 
 

Action details: heart_strike

Static Values
  • id:206930
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.dancing_rune_weapon.up|rune.time_to_4<gcd
Spelldata
  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}. |cFFFFFFFFGenerates {$?s221536=false}[${{$s3=5}+{$221536s1=0}}][{$s3=5}] bonus Runic Power{$?s221536=false}[, plus ${{$210738s1=20}/10} Runic Power per additional enemy struck][].|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Marrowrend 396 4.3% 23.7 12.84sec 5000 4660 Direct 23.7 4008 7998 5000 24.9% 3.0%  

Stats details: marrowrend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.70 23.70 0.00 0.00 1.0730 0.0000 118498.64 170951.98 30.68 4660.16 4660.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 72.90% 4044.38 3533 4963 4045.83 3801 4327 69873 99892 30.05
hit (blocked) 0.53 2.23% 2832.55 2473 3474 1172.19 0 3474 1497 3058 21.10
crit 5.71 24.10% 8072.49 7066 9926 8060.08 0 9666 46106 65913 29.99
crit (blocked) 0.18 0.76% 5651.24 4946 6766 940.65 0 6766 1023 2089 8.50
 
 

Action details: marrowrend

Static Values
  • id:195182
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
Spelldata
  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. |Tinterface\icons\ability_deathknight_boneshield.blp:24|t |cFFFFFFFFBone Shield|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Rune Strike 219 2.4% 8.0 38.23sec 8150 7651 Direct 8.0 6506 13010 8150 25.3% 2.9%  

Stats details: rune_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.04 8.04 0.00 0.00 1.0653 0.0000 65512.88 94467.14 30.65 7650.69 7650.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.82 72.46% 6565.19 5644 7929 6566.37 0 7518 38239 54667 30.05
hit (blocked) 0.18 2.26% 4599.65 3951 5405 765.72 0 5405 835 1705 8.49
crit 1.98 24.62% 13113.52 11288 15857 11664.79 0 15857 25954 37104 26.73
crit (blocked) 0.05 0.66% 9137.51 7901 10810 481.43 0 10810 485 990 2.69
 
 

Action details: rune_strike

Static Values
  • id:210764
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
Spelldata
  • id:210764
  • name:Rune Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage. Cooldown reduced by {$s2=1} sec for every Rune you spend. |cFFFFFFFFGenerates {$s2=1} Rune.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Touch of the Grave 228 2.5% 18.0 17.04sec 3797 0 Direct 18.0 3035 6065 3797 25.1% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 17.96 0.00 0.00 0.0000 0.0000 68214.46 68214.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.45 74.86% 3035.48 2598 3841 3036.41 2765 3264 40821 40821 0.00
crit 4.52 25.14% 6064.94 5196 7682 6031.90 0 7481 27394 27394 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing $<damage> Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.312500
  • spell_power_mod.direct:0.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Wasting Infection 100 1.1% 7.8 35.63sec 3840 0 Periodic 43.2 553 1105 692 25.3% 0.0% 28.5%

Stats details: wasting_infection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.79 0.00 43.21 43.21 0.0000 1.9778 29920.34 29920.34 0.00 350.08 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.3 74.70% 552.65 1 572 553.04 513 568 17838 17838 0.00
crit 10.9 25.30% 1104.99 2 1145 1105.64 0 1145 12082 12082 0.00
 
 

Action details: wasting_infection

Static Values
  • id:278110
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278110
  • name:Wasting Infection
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. The caster's attacks will grant them Critical Strike.
  • description:
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:507.28
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - dancing_rune_weapon 3251 / 259
Blood Boil 324 0.3% 3.4 75.61sec 2233 0 Direct 3.4 1811 3614 2233 23.4% 0.0%  

Stats details: blood_boil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.43 3.43 0.00 0.00 0.0000 0.0000 7666.50 7666.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.63 76.55% 1810.55 1479 2078 1794.84 0 2078 4758 4758 0.00
crit 0.80 23.45% 3613.65 2959 4156 2140.95 0 4156 2909 2909 0.00
 
 

Action details: blood_boil

Static Values
  • id:50842
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within $A1 yds.][ and infects all enemies within $A1 yds with Blood Plague. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A shadowy disease that drains $o1 health from the target over {$d=24 seconds}. }]
 
Blood Plague 429 0.4% 3.4 75.61sec 2954 0 Periodic 22.6 358 715 448 25.3% 0.0% 22.2%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.43 0.00 22.62 22.62 0.0000 2.9409 10139.69 10139.69 0.00 152.44 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.9 74.70% 357.84 8 431 357.99 312 402 6047 6047 0.00
crit 5.7 25.30% 715.38 71 862 712.94 0 855 4093 4093 0.00
 
 

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining $w1 health from the target every $t1 sec.
  • description:A shadowy disease that drains $o1 health from the target over {$d=24 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.062244
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Death Strike 722 0.6% 3.8 42.29sec 4488 0 Direct 3.8 3578 7153 4489 25.5% 0.0%  

Stats details: death_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.82 3.82 0.00 0.00 0.0000 0.0000 17154.19 24523.97 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.85 74.53% 3577.65 2882 4574 3544.31 0 4454 10190 14568 29.76
crit 0.97 25.47% 7153.00 5764 9148 4778.44 0 9147 6964 9956 20.08
 
 

Action details: death_strike

Static Values
  • id:49998
  • school:physical
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heart Strike 408 0.4% 7.7 35.30sec 1250 0 Direct 7.7 998 1995 1250 25.3% 0.0%  

Stats details: heart_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.74 7.74 0.00 0.00 0.0000 0.0000 9676.15 13833.22 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.78 74.68% 997.73 835 1173 998.38 835 1153 5766 8243 30.05
crit 1.96 25.32% 1995.17 1671 2347 1776.05 0 2347 3910 5590 26.75
 
 

Action details: heart_strike

Static Values
  • id:206930
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}. |cFFFFFFFFGenerates {$?s221536=false}[${{$s3=5}+{$221536s1=0}}][{$s3=5}] bonus Runic Power{$?s221536=false}[, plus ${{$210738s1=20}/10} Runic Power per additional enemy struck][].|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
main_hand 786 0.7% 7.9 34.79sec 2350 938 Direct 7.9 1882 3766 2350 24.8% 0.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.93 7.93 0.00 0.00 2.5055 0.0000 18625.16 26626.90 30.05 938.01 938.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.96 75.17% 1882.30 1560 2191 1883.47 1608 2115 11214 16032 30.05
crit 1.97 24.83% 3766.07 3119 4382 3364.32 0 4382 7411 10595 26.85
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Marrowrend 309 0.3% 3.7 43.24sec 1946 0 Direct 3.7 1589 3180 1946 22.4% 0.0%  

Stats details: marrowrend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.75 3.75 0.00 0.00 0.0000 0.0000 7294.37 10428.17 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.91 77.55% 1589.50 1295 1820 1584.22 0 1804 4620 6604 29.91
crit 0.84 22.45% 3179.69 2591 3639 1929.18 0 3639 2675 3824 18.23
 
 

Action details: marrowrend

Static Values
  • id:195182
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. |Tinterface\icons\ability_deathknight_boneshield.blp:24|t |cFFFFFFFFBone Shield|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Rune Strike 273 0.2% 2.0 2.47sec 3222 0 Direct 2.0 2594 5182 3222 24.3% 0.0%  

Stats details: rune_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 6445.90 9215.19 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.51 75.72% 2593.96 2324 2907 2438.36 0 2907 3929 5617 28.26
crit 0.49 24.28% 5182.09 4256 5814 2205.77 0 5814 2517 3598 12.79
 
 

Action details: rune_strike

Static Values
  • id:210764
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210764
  • name:Rune Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage. Cooldown reduced by {$s2=1} sec for every Rune you spend. |cFFFFFFFFGenerates {$s2=1} Rune.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bloodworm 1360 / 890
main_hand 1360 9.7% 400.6 0.74sec 666 659 Direct 400.6 532 1063 666 25.3% 0.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 400.60 400.60 0.00 0.00 1.0110 0.0000 266924.08 381600.02 30.05 659.07 659.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 299.27 74.71% 531.88 468 657 532.00 506 564 159175 227560 30.05
crit 101.33 25.29% 1063.35 936 1315 1063.58 1008 1141 107749 154040 30.05
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
T22_Death_Knight_Blood 45
Blood Shield 22 33.4% 44.4 6.55sec 150 0 Direct 157.7 42 0 42 0.0%  

Stats details: blood_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 44.42 157.72 0.00 0.00 0.0000 0.0000 6660.50 3461594.96 99.81 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.72 100.00% 42.23 0 186 42.20 39 44 6660 3461595 99.78
 
 

Action details: blood_shield

Static Values
  • id:77535
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:77535
  • name:Blood Shield
  • school:shadow
  • tooltip:Absorbs $w1 Physical damage.
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:200529.80
  • base_dd_max:200529.80
 
Death Strike (_heal) 33 48.5% 44.4 6.55sec 218 0 Direct 44.4 218 0 218 0.0%  

Stats details: death_strike_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 44.42 44.42 0.00 0.00 0.0000 0.0000 9684.69 1076175.06 99.10 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.42 100.00% 218.02 0 2000 220.76 53 369 9685 1076175 99.09
 
 

Action details: death_strike_heal

Static Values
  • id:45470
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:45470
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc49998=Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.}
 
Unholy Strength 12 18.1% 23.7 12.66sec 152 0 Direct 23.7 152 0 152 0.0%  

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 23.74 23.74 0.00 0.00 0.0000 0.0000 3615.31 447417.15 99.19 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.74 100.00% 152.29 0 2000 155.02 0 431 3615 447417 99.18
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 
Simple Action Stats Execute Interval
T22_Death_Knight_Blood
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
Dancing Rune Weapon 3.0 120.30sec

Stats details: dancing_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 1.1764 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dancing_rune_weapon

Static Values
  • id:49028
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
Spelldata
  • id:49028
  • name:Dancing Rune Weapon
  • school:physical
  • tooltip:
  • description:Summons a rune weapon for {$s4=8} sec that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=40}% parry chance.
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
Mind Freeze 10.6 29.39sec

Stats details: mind_freeze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mind_freeze

Static Values
  • id:47528
  • school:frost
  • resource:runic_power
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47528
  • name:Mind Freeze
  • school:frost
  • tooltip:
  • description:Smash the target's mind with cold, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:stamina
  • amount:18.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=4}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Strength 2.0 0.0 121.5sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_battle_potion_of_strength
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:900.00

Stack Uptimes

  • battle_potion_of_strength_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279153
  • name:Battle Potion of Strength
  • tooltip:Strength increased by $w1.
  • description:Increases your Strength by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Blood Shield 4.5 40.0 65.1sec 6.6sec 94.87% 100.00% 40.0(40.0) 3.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_blood_shield
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_shield_1:94.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:77535
  • name:Blood Shield
  • tooltip:Absorbs $w1 Physical damage.
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bone Shield 1.0 21.7 202.7sec 13.4sec 99.57% 99.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_bone_shield
  • max_stacks:10
  • duration:30.00
  • cooldown:2.50
  • default_chance:100.00%
  • default_value:0.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bone_shield_1:0.00%
  • bone_shield_2:0.00%
  • bone_shield_3:0.94%
  • bone_shield_4:4.81%
  • bone_shield_5:33.11%
  • bone_shield_6:32.92%
  • bone_shield_7:27.78%
  • bone_shield_8:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195181
  • name:Bone Shield
  • tooltip:Armor increased by ${$w1*$STR/100}. Haste increased by $w4%.
  • description:Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Scourge 15.2 1.1 19.6sec 18.3sec 6.72% 0.00% 1.1(1.1) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_crimson_scourge
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • crimson_scourge_1:6.72%

Trigger Attempt Success

  • trigger_pct:25.50%

Spelldata details

  • id:81141
  • name:Crimson Scourge
  • tooltip:Your next Death and Decay costs no Runes and generates no Runic Power.
  • description:{$@spelldesc81136=Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spell details

  • id:81136
  • name:Crimson Scourge
  • tooltip:
  • description:Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
Critical Prowess 1.0 131.5 0.0sec 2.3sec 100.00% 0.00% 127.5(127.5) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_critical_prowess
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Syringe of Bloodborne Infirmity

Stat Buff details

  • stat:crit_rating
  • amount:96.22

Stack Uptimes

  • critical_prowess_1:0.43%
  • critical_prowess_2:0.62%
  • critical_prowess_3:0.45%
  • critical_prowess_4:0.65%
  • critical_prowess_5:97.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278108
  • name:Critical Prowess
  • tooltip:Increases your Critical Strike by $w1.
  • description:
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Dancing Rune Weapon 3.0 0.0 120.3sec 120.3sec 7.98% 9.38% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_dancing_rune_weapon
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dancing_rune_weapon_1:7.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81256
  • name:Dancing Rune Weapon
  • tooltip:Parry chance increased by {$s1=40}%.
  • description:{$@spelldesc49028=Summons a rune weapon for {$s4=8} sec that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=40}% parry chance.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.7 0.2 74.2sec 66.0sec 9.03% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_crit_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 75.7sec 67.1sec 9.01% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_haste_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 74.2sec 65.9sec 8.97% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.7 0.2 74.5sec 65.9sec 9.12% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Hemostasis 39.6 16.6 7.6sec 5.3sec 67.15% 87.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_hemostasis
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • hemostasis_1:50.17%
  • hemostasis_2:15.75%
  • hemostasis_3:0.89%
  • hemostasis_4:0.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273947
  • name:Hemostasis
  • tooltip:Damage and healing done by your next Death Strike increased by {$s1=8}%.
  • description:{$@spelldesc273946=Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:273946
  • name:Hemostasis
  • tooltip:
  • description:Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Incite the Pack 4.1 1.5 66.9sec 45.6sec 31.02% 0.00% 1.5(1.5) 3.8

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_incite_the_pack
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:479.00

Stack Uptimes

  • incite_the_pack_1:31.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280412
  • name:Incite the Pack
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc280410=You occasionally loose a tremendous roar, increasing your Mastery by {$s1=227} and granting {$s2=53} Mastery to up to $280413i nearby allies. Lasts {$280412d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 5.1 0.0 58.2sec 35.9sec 38.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.52%
  • overwhelming_power_2:1.53%
  • overwhelming_power_3:1.53%
  • overwhelming_power_4:1.54%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.55%
  • overwhelming_power_7:1.55%
  • overwhelming_power_8:1.56%
  • overwhelming_power_9:1.56%
  • overwhelming_power_10:1.57%
  • overwhelming_power_11:1.58%
  • overwhelming_power_12:1.58%
  • overwhelming_power_13:1.59%
  • overwhelming_power_14:1.59%
  • overwhelming_power_15:1.60%
  • overwhelming_power_16:1.60%
  • overwhelming_power_17:1.61%
  • overwhelming_power_18:1.61%
  • overwhelming_power_19:1.61%
  • overwhelming_power_20:1.62%
  • overwhelming_power_21:1.63%
  • overwhelming_power_22:1.63%
  • overwhelming_power_23:1.64%
  • overwhelming_power_24:1.67%
  • overwhelming_power_25:0.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 100.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.7 15.0 35.6sec 12.6sec 73.37% 72.04% 15.0(15.0) 8.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • unholy_strength_1:73.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 25.6 27.4 11.9sec 5.7sec 66.23% 0.00% 2.0(2.0) 24.9

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.08%
  • unstable_flames_2:16.41%
  • unstable_flames_3:8.54%
  • unstable_flames_4:4.43%
  • unstable_flames_5:4.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Undertow

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_flask_of_the_undertow
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:238.00

Stack Uptimes

  • flask_of_the_undertow_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251839
  • name:Flask of the Undertow
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (swamp_fish_n_chips)

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_swamp_fish_n_chips
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:70.00

Stack Uptimes

  • swamp_fish_n_chips_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:257415
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=70} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
parry_haste 32.7 8.8sec
Rune ready 130.2 2.6sec
Bloodworms 28.3 10.6sec

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=36122)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0051.388 / 1.2653.1275.109
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
5.4835.6016.685 / 6.5238.47714.249

Resources

Resource Usage Type Count Total Average RPE APR
T22_Death_Knight_Blood
death_strike Runic Power 44.4 1788.7 40.3 40.3 302.2
heart_strike Rune 87.1 87.1 1.0 1.0 3217.5
marrowrend Rune 23.7 47.4 2.0 2.0 2500.2
pet - dancing_rune_weapon
death_strike Runic Power 3.8 172.0 45.0 45.0 99.7
heart_strike Rune 7.7 7.7 1.0 1.0 1250.3
marrowrend Rune 3.7 7.5 2.0 2.0 973.2
Resource Gains Type Count Total Average Overflow
death_strike_heal Health 44.42 9684.77 (72.82%) 218.02 1066490.84 99.10%
marrowrend Runic Power 23.70 467.77 (25.81%) 19.74 6.19 1.31%
heart_strike Runic Power 87.07 1306.09 (72.06%) 15.00 0.00 0.00%
unholy_strength Health 23.74 3615.23 (27.18%) 152.29 443795.68 99.19%
Rune Regeneration Rune 122.16 122.16 (93.83%) 1.00 0.00 0.00%
Rune Weapon Heart Strike Runic Power 7.74 38.69 (2.13%) 5.00 0.00 0.00%
Rune Strike Rune 8.04 8.04 (6.17%) 1.00 0.00 0.00%
pet - dancing_rune_weapon
rune_strike Rune 2.00 0.00 (0.00%) 0.00 2.00 100.00%
Resource RPS-Gain RPS-Loss
Health 44.33 0.00
Runic Power 6.04 5.96
Rune 0.43 0.45
Combat End Resource Mean Min Max
Runic Power 23.74 0.00 75.00
Rune 1.73 0.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 1.0%

Statistics & Data Analysis

Fight Length
Sample Data T22_Death_Knight_Blood Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Death_Knight_Blood Damage Per Second
Count 7499
Mean 9136.86
Minimum 8365.50
Maximum 10062.91
Spread ( max - min ) 1697.42
Range [ ( max - min ) / 2 * 100% ] 9.29%
Standard Deviation 235.9520
5th Percentile 8763.21
95th Percentile 9539.60
( 95th Percentile - 5th Percentile ) 776.39
Mean Distribution
Standard Deviation 2.7247
95.00% Confidence Intervall ( 9131.52 - 9142.20 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2562
0.1 Scale Factor Error with Delta=300 476
0.05 Scale Factor Error with Delta=300 1902
0.01 Scale Factor Error with Delta=300 47526
Priority Target DPS
Sample Data T22_Death_Knight_Blood Priority Target Damage Per Second
Count 7499
Mean 9136.86
Minimum 8365.50
Maximum 10062.91
Spread ( max - min ) 1697.42
Range [ ( max - min ) / 2 * 100% ] 9.29%
Standard Deviation 235.9520
5th Percentile 8763.21
95th Percentile 9539.60
( 95th Percentile - 5th Percentile ) 776.39
Mean Distribution
Standard Deviation 2.7247
95.00% Confidence Intervall ( 9131.52 - 9142.20 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2562
0.1 Scale Factor Error with Delta=300 476
0.05 Scale Factor Error with Delta=300 1902
0.01 Scale Factor Error with Delta=300 47526
DPS(e)
Sample Data T22_Death_Knight_Blood Damage Per Second (Effective)
Count 7499
Mean 9136.86
Minimum 8365.50
Maximum 10062.91
Spread ( max - min ) 1697.42
Range [ ( max - min ) / 2 * 100% ] 9.29%
Damage
Sample Data T22_Death_Knight_Blood Damage
Count 7499
Mean 2394247.33
Minimum 1811510.35
Maximum 3001609.37
Spread ( max - min ) 1190099.02
Range [ ( max - min ) / 2 * 100% ] 24.85%
DTPS
Sample Data T22_Death_Knight_Blood Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS
Sample Data T22_Death_Knight_Blood Healing Per Second
Count 7499
Mean 44.94
Minimum 36.95
Maximum 55.41
Spread ( max - min ) 18.47
Range [ ( max - min ) / 2 * 100% ] 20.55%
Standard Deviation 5.2743
5th Percentile 37.57
95th Percentile 54.06
( 95th Percentile - 5th Percentile ) 16.49
Mean Distribution
Standard Deviation 0.0609
95.00% Confidence Intervall ( 44.82 - 45.06 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 530
0.1% Error 52915
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 1
0.01 Scale Factor Error with Delta=300 24
HPS(e)
Sample Data T22_Death_Knight_Blood Healing Per Second (Effective)
Count 7499
Mean 44.94
Minimum 36.95
Maximum 55.41
Spread ( max - min ) 18.47
Range [ ( max - min ) / 2 * 100% ] 20.55%
Heal
Sample Data T22_Death_Knight_Blood Heal
Count 7499
Mean 13300.00
Minimum 13300.00
Maximum 13300.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Death_Knight_Blood Healing Taken Per Second
Count 7499
Mean 44.94
Minimum 36.95
Maximum 55.41
Spread ( max - min ) 18.47
Range [ ( max - min ) / 2 * 100% ] 20.55%
TMI
Sample Data T22_Death_Knight_Blood Theck-Meloree Index
Count 7499
Mean 52205.21
Minimum 50187.63
Maximum 53500.71
Spread ( max - min ) 3313.08
Range [ ( max - min ) / 2 * 100% ] 3.17%
Standard Deviation 396.6538
5th Percentile 51537.38
95th Percentile 52817.06
( 95th Percentile - 5th Percentile ) 1279.68
Mean Distribution
Standard Deviation 4.5805
95.00% Confidence Intervall ( 52196.23 - 52214.19 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3
0.1% Error 222
0.1 Scale Factor Error with Delta=300 1344
0.05 Scale Factor Error with Delta=300 5373
0.01 Scale Factor Error with Delta=300 134310
ETMI
Sample Data T22_Death_Knight_BloodTheck-Meloree Index (Effective)
Count 7499
Mean 61008.35
Minimum 60967.35
Maximum 61037.84
Spread ( max - min ) 70.49
Range [ ( max - min ) / 2 * 100% ] 0.06%
MSD
Sample Data T22_Death_Knight_Blood Max Spike Value
Count 3774
Mean 0.00
Minimum -0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 587.88%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 10.59 mind_freeze
0.00 blood_fury,if=cooldown.dancing_rune_weapon.ready&(!cooldown.blooddrinker.ready|!talent.blooddrinker.enabled)
0.00 berserking
0.00 use_items
7 1.00 potion,if=buff.dancing_rune_weapon.up
8 2.99 dancing_rune_weapon,if=!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
0.00 tombstone,if=buff.bone_shield.stack>=7
9 0.00 call_action_list,name=standard
actions.standard
# count action,conditions
A 28.65 death_strike,if=runic_power.deficit<=10
0.00 blooddrinker,if=!buff.dancing_rune_weapon.up
B 1.24 marrowrend,if=(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
C 4.43 blood_boil,if=charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
D 22.46 marrowrend,if=buff.bone_shield.stack<5&talent.ossuary.enabled&runic_power.deficit>=15
0.00 bonestorm,if=runic_power>=100&!buff.dancing_rune_weapon.up
E 15.77 death_strike,if=runic_power.deficit<=(15+buff.dancing_rune_weapon.up*5+spell_targets.heart_strike*talent.heartbreaker.enabled*2)|target.time_to_die<10
0.00 death_and_decay,if=spell_targets.death_and_decay>=3
F 2.00 rune_strike,if=(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
G 22.60 heart_strike,if=buff.dancing_rune_weapon.up|rune.time_to_4<gcd
H 0.60 blood_boil,if=buff.dancing_rune_weapon.up
I 15.17 death_and_decay,if=buff.crimson_scourge.up|talent.rapid_decomposition.enabled|spell_targets.death_and_decay>=2
0.00 consumption
J 51.17 blood_boil
K 64.48 heart_strike,if=rune.time_to_3<gcd|buff.bone_shield.stack>6
L 6.04 rune_strike
0.00 arcane_torrent,if=runic_power.deficit>20

Sample Sequence

012458B6CDDFCGFGIJJKEGDJKAKJKEKJKKADJKKAJKJKE6DJIKJLGAGGDAJKJIKAKJKDAJKIKAJ6KKDAJIJKKALDJKEKJKIJGADKEJK6JKKA87DGECGGEICJKKLDAJKIKEJKKJKA6KJDEKKJIKAJ6KDEJKJKKALJDKEKJI6KKAJKDEJKKKAJ6KJDEKJIKJKADK6EJLKKJKADJI8GEGGEG6CJKKADIJKAJ6KJKKADJLKEIJKKDAJKI6JEEDJKEKJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 1 food T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 2 augmentation T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 4 potion Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune battle_potion_of_strength
0:00.000 default 5 auto_attack Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/304060: 100% health | 6.0/6: 100% rune resounding_protection, archive_of_the_titans, battle_potion_of_strength
0:00.000 default 8 dancing_rune_weapon Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/304060: 100% health | 6.0/6: 100% rune unholy_strength, resounding_protection, archive_of_the_titans, critical_prowess, battle_potion_of_strength
0:01.265 standard B marrowrend Fluffy_Pillow 0.0/125: 0% runic_power | 304060.0/304060: 100% health | 6.0/6: 100% rune bloodlust, dancing_rune_weapon, unholy_strength, resounding_protection, archive_of_the_titans, critical_prowess, battle_potion_of_strength
0:02.239 default 6 mind_freeze Fluffy_Pillow 20.0/125: 16% runic_power | 304060.0/304060: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:02.239 standard C blood_boil Fluffy_Pillow 20.0/125: 16% runic_power | 304060.0/304060: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:03.125 standard D marrowrend Fluffy_Pillow 20.0/125: 16% runic_power | 304060.0/304060: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:04.011 standard D marrowrend Fluffy_Pillow 40.0/125: 32% runic_power | 304060.0/304060: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(3), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, critical_prowess(3), battle_potion_of_strength
0:04.897 standard F rune_strike Fluffy_Pillow 60.0/125: 48% runic_power | 304060.0/304060: 100% health | 0.0/6: 0% rune bloodlust, bone_shield(6), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, critical_prowess(4), battle_potion_of_strength
0:05.784 standard C blood_boil Fluffy_Pillow 60.0/125: 48% runic_power | 304060.0/304720: 100% health | 1.0/6: 17% rune bloodlust, bone_shield(6), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(2), critical_prowess(4), battle_potion_of_strength
0:06.671 standard G heart_strike Fluffy_Pillow 60.0/125: 48% runic_power | 304060.0/304720: 100% health | 1.0/6: 17% rune bloodlust, bone_shield(5), crimson_scourge, dancing_rune_weapon, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:07.558 standard F rune_strike Fluffy_Pillow 80.0/125: 64% runic_power | 304060.0/304720: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(5), crimson_scourge, dancing_rune_weapon, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:08.445 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 304060.0/304720: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), crimson_scourge, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(24), archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:09.271 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 304060.0/304720: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), crimson_scourge, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(23), archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:10.099 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 304060.0/305400: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(22), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:10.928 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 304060.0/305400: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), hemostasis(3), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(22), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:11.759 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 304060.0/305400: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), hemostasis(4), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(21), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:12.590 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 304060.0/305400: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(5), hemostasis(4), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(20), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:13.426 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 305400.0/305400: 100% health | 4.0/6: 67% rune bloodlust, blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(19), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:14.264 standard D marrowrend Fluffy_Pillow 85.0/125: 68% runic_power | 305400.0/305400: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(18), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:15.101 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 305400.0/306060: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), resounding_protection, unstable_flames(2), overwhelming_power(17), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:15.945 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 305400.0/306060: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames(2), overwhelming_power(17), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:16.786 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 305400.0/306060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), hemostasis, resounding_protection, overwhelming_power(16), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:17.631 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 306060.0/306060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), resounding_protection, overwhelming_power(15), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:18.479 Waiting     0.500 sec 95.0/125: 76% runic_power | 306060.0/306060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), resounding_protection, overwhelming_power(14), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:18.979 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 306060.0/306060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), resounding_protection, overwhelming_power(14), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:20.044 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 306060.0/306720: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(6), hemostasis, resounding_protection, overwhelming_power(12), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:20.898 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 306060.0/306720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis, resounding_protection, overwhelming_power(12), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:21.752 Waiting     1.400 sec 70.0/125: 56% runic_power | 306720.0/306720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, overwhelming_power(11), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:23.152 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 306720.0/306720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), unholy_strength, resounding_protection, overwhelming_power(9), archive_of_the_titans(5), critical_prowess(5)
0:24.014 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 306720.0/306720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(8), archive_of_the_titans(5), critical_prowess(5)
0:24.880 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 306720.0/306720: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(8), archive_of_the_titans(5), critical_prowess(5)
0:25.744 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 306720.0/307380: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(7), archive_of_the_titans(6), critical_prowess(5)
0:26.612 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 307380.0/307380: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, overwhelming_power(6), archive_of_the_titans(6), critical_prowess(5)
0:27.481 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 307380.0/307380: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, overwhelming_power(5), archive_of_the_titans(6), critical_prowess(5)
0:28.355 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 307380.0/307380: 100% health | 0.0/6: 0% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(4), archive_of_the_titans(6), critical_prowess(5)
0:29.232 Waiting     0.500 sec 90.0/125: 72% runic_power | 307380.0/307380: 100% health | 0.0/6: 0% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(3), archive_of_the_titans(6), critical_prowess(5)
0:29.732 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 307380.0/307380: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(3), archive_of_the_titans(6), critical_prowess(5)
0:30.611 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 307380.0/308060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(2), archive_of_the_titans(7), critical_prowess(5)
0:31.493 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 307380.0/308060: 100% health | 0.0/6: 0% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power, archive_of_the_titans(7), critical_prowess(5)
0:32.376 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 308060.0/308060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(7), critical_prowess(5)
0:33.262 Waiting     2.300 sec 80.0/125: 64% runic_power | 308060.0/308060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(7), critical_prowess(5)
0:35.562 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 308060.0/308720: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:36.448 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 308060.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:37.449 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 308060.0/308720: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:38.337 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 308060.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:39.223 Waiting     0.800 sec 70.0/125: 56% runic_power | 308720.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:40.023 default 6 mind_freeze Fluffy_Pillow 70.0/125: 56% runic_power | 308720.0/309380: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(9), critical_prowess(5)
0:40.023 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 308720.0/309380: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(9), critical_prowess(5)
0:40.909 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 308720.0/309380: 100% health | 0.0/6: 0% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, archive_of_the_titans(9), critical_prowess(5)
0:41.859 standard I death_and_decay Fluffy_Pillow 90.0/125: 72% runic_power | 309380.0/309380: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(9), critical_prowess(5)
0:43.009 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 309380.0/309380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(23), archive_of_the_titans(9), critical_prowess(5)
0:44.085 Waiting     2.100 sec 105.0/125: 84% runic_power | 309380.0/309380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(22), archive_of_the_titans(9), critical_prowess(5)
0:46.185 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 309380.0/310040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(19), archive_of_the_titans(10), critical_prowess(5)
0:47.471 standard L rune_strike Fluffy_Pillow 105.0/125: 84% runic_power | 309380.0/310040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, overwhelming_power(18), archive_of_the_titans(10), critical_prowess(5)
0:48.562 standard G heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 309380.0/310040: 100% health | 3.0/6: 50% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, overwhelming_power(17), archive_of_the_titans(10), critical_prowess(5)
0:49.656 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 309380.0/310040: 100% health | 3.0/6: 50% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, overwhelming_power(16), archive_of_the_titans(10), critical_prowess(5)
0:50.753 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 310040.0/310720: 100% health | 4.0/6: 67% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(15), archive_of_the_titans(11), critical_prowess(5)
0:51.854 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 310040.0/310720: 100% health | 4.0/6: 67% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(14), archive_of_the_titans(11), critical_prowess(5)
0:52.958 standard D marrowrend Fluffy_Pillow 110.0/125: 88% runic_power | 310040.0/310720: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(13), archive_of_the_titans(11), critical_prowess(5)
0:54.065 standard A death_strike Fluffy_Pillow 125.0/125: 100% runic_power | 310040.0/310720: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(11), archive_of_the_titans(11), critical_prowess(5)
0:55.179 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 310720.0/311380: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(10), archive_of_the_titans(12), critical_prowess(5)
0:56.295 Waiting     0.800 sec 85.0/125: 68% runic_power | 311380.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(9), archive_of_the_titans(12), critical_prowess(5)
0:57.095 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 311380.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(8), archive_of_the_titans(12), critical_prowess(5)
0:58.219 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 311380.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(3), overwhelming_power(7), archive_of_the_titans(12), critical_prowess(5)
0:59.346 standard I death_and_decay Fluffy_Pillow 100.0/125: 80% runic_power | 311380.0/311380: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(4), overwhelming_power(6), archive_of_the_titans(12), critical_prowess(5)
1:00.478 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 311380.0/312040: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(4), overwhelming_power(5), archive_of_the_titans(13), critical_prowess(5)
1:01.612 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 311380.0/312040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(4), overwhelming_power(4), archive_of_the_titans(13), critical_prowess(5)
1:02.750 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 312040.0/312040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(5), overwhelming_power(3), archive_of_the_titans(13), critical_prowess(5)
1:03.891 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 312040.0/312040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(5), overwhelming_power(2), archive_of_the_titans(13), critical_prowess(5)
1:05.036 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 312040.0/312700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(14), critical_prowess(5)
1:06.154 standard D marrowrend Fluffy_Pillow 105.0/125: 84% runic_power | 312040.0/312700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames(5), archive_of_the_titans(14), critical_prowess(5)
1:07.273 standard A death_strike Fluffy_Pillow 125.0/125: 100% runic_power | 312040.0/312700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(14), critical_prowess(5)
1:08.392 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 312700.0/312700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(14), critical_prowess(5)
1:09.731 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 312700.0/312700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(14), critical_prowess(5)
1:10.849 Waiting     0.100 sec 100.0/125: 80% runic_power | 312700.0/313380: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:10.949 standard I death_and_decay Fluffy_Pillow 100.0/125: 80% runic_power | 312700.0/313380: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:12.067 Waiting     1.100 sec 100.0/125: 80% runic_power | 312700.0/313380: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:13.167 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 312700.0/313380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:14.287 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 312700.0/313380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:15.438 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 313380.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:16.591 Waiting     0.500 sec 75.0/125: 60% runic_power | 313380.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:17.091 default 6 mind_freeze Fluffy_Pillow 75.0/125: 60% runic_power | 313380.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:17.091 Waiting     0.500 sec 75.0/125: 60% runic_power | 313380.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:17.591 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 313380.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:18.743 Waiting     0.900 sec 90.0/125: 72% runic_power | 313380.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:19.643 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 314040.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:20.793 standard D marrowrend Fluffy_Pillow 105.0/125: 84% runic_power | 314040.0/314700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:21.945 standard A death_strike Fluffy_Pillow 125.0/125: 100% runic_power | 314040.0/314700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:23.098 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 314700.0/314700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:24.250 standard I death_and_decay Fluffy_Pillow 85.0/125: 68% runic_power | 314700.0/314700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:25.402 Waiting     0.100 sec 85.0/125: 68% runic_power | 314700.0/315360: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:25.502 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 314700.0/315360: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:26.815 Waiting     0.400 sec 85.0/125: 68% runic_power | 314700.0/315360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:27.215 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 314700.0/315360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:28.366 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 314700.0/315360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:29.517 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 314700.0/315360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:30.668 standard L rune_strike Fluffy_Pillow 75.0/125: 60% runic_power | 315360.0/316040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, archive_of_the_titans(19), critical_prowess(5)
1:32.049 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 315360.0/316040: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, archive_of_the_titans(19), critical_prowess(5)
1:33.200 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 315360.0/316040: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, archive_of_the_titans(19), critical_prowess(5)
1:34.352 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 315360.0/316040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(19), critical_prowess(5)
1:35.501 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 315360.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:36.653 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:37.804 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:38.955 Waiting     1.500 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:40.455 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:41.604 Waiting     0.100 sec 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:41.704 standard I death_and_decay Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:42.853 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:44.018 standard G heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:45.170 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
1:46.320 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
1:47.471 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
1:48.623 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
1:49.776 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
1:50.928 Waiting     0.400 sec 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:51.328 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:52.481 Waiting     1.600 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:54.081 default 6 mind_freeze Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:54.081 Waiting     0.100 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:54.181 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:55.489 Waiting     0.300 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:55.789 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:56.943 Waiting     0.900 sec 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:57.843 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
1:58.995 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
2:00.066 default 8 dancing_rune_weapon Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
2:01.143 default 7 potion Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
2:01.143 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:02.224 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:03.308 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:04.396 standard C blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:05.486 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(2), overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:06.580 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:07.678 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:08.779 standard I death_and_decay Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:09.884 standard C blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:10.991 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:12.101 Waiting     0.200 sec 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:12.301 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:13.417 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:14.536 Waiting     0.200 sec 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:14.736 standard L rune_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:16.022 standard D marrowrend Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:17.152 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(3), overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:18.285 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(3), overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:19.421 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:20.562 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, resounding_protection, unstable_flames(3), overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:21.707 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, unstable_flames(3), overwhelming_power, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:22.856 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:24.007 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:25.158 Waiting     0.300 sec 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:25.458 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:26.609 Waiting     0.900 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
2:27.509 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
2:28.660 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, unstable_flames, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
2:29.731 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, unstable_flames, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
2:30.805 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), resounding_protection, unstable_flames, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
2:31.882 Waiting     0.200 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, unstable_flames, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
2:32.082 default 6 mind_freeze Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, unstable_flames, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
2:32.082 Waiting     0.600 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, unstable_flames, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
2:32.682 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
2:33.766 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
2:34.853 standard D marrowrend Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, resounding_protection, overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
2:35.944 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
2:37.039 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), resounding_protection, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
2:38.138 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
2:39.240 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
2:40.345 Waiting     1.800 sec 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
2:42.145 standard I death_and_decay Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
2:43.261 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
2:44.381 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
2:45.506 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
2:46.633 Waiting     0.200 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
2:46.833 default 6 mind_freeze Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
2:47.082 Waiting     0.400 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5)
2:47.482 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5)
2:48.615 standard D marrowrend Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)
2:49.753 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
2:50.895 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
2:52.039 Waiting     3.000 sec 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:55.039 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
2:56.190 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:57.342 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:58.492 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
2:59.643 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
3:00.795 standard L rune_strike Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames(3), overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
3:01.866 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames(3), overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
3:02.941 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames(3), overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
3:04.024 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames(3), overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
3:05.111 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
3:06.202 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
3:07.297 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
3:08.394 standard I death_and_decay Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
3:09.464 default 6 mind_freeze Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
3:09.464 Waiting     0.200 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
3:09.664 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
3:10.740 Waiting     0.800 sec 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
3:11.540 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
3:12.620 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
3:13.703 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
3:14.789 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
3:15.877 Waiting     0.200 sec 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
3:16.077 standard D marrowrend Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
3:17.173 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
3:18.273 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5)
3:19.405 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)
3:20.542 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
3:21.682 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
3:22.827 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, overwhelming_power, archive_of_the_titans(20), critical_prowess(5)
3:23.977 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:25.128 Waiting     2.000 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:27.128 default 6 mind_freeze Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:27.128 Waiting     0.500 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:27.628 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:28.781 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:29.933 Waiting     0.100 sec 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:30.033 standard D marrowrend Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:31.183 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:32.335 Waiting     0.900 sec 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:33.235 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:34.387 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:35.608 Waiting     0.400 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:36.008 standard I death_and_decay Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:37.161 Waiting     2.600 sec 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:39.761 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(20), critical_prowess(5)
3:40.914 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(20), critical_prowess(5)
3:42.065 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(20), critical_prowess(5)
3:43.217 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(20), critical_prowess(5)
3:44.370 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:45.521 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:46.671 default 6 mind_freeze Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:46.671 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
3:47.823 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
3:48.973 standard L rune_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
3:50.125 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
3:51.274 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
3:52.426 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
3:53.579 Waiting     1.400 sec 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:54.979 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:56.132 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:57.284 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:58.437 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
3:59.508 standard I death_and_decay Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), crimson_scourge, hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
4:00.581 default 8 dancing_rune_weapon Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
4:01.659 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
4:02.741 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
4:03.828 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
4:04.918 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
4:06.010 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
4:07.111 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
4:08.216 default 6 mind_freeze Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
4:08.216 standard C blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
4:09.323 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
4:10.434 Waiting     1.200 sec 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
4:11.634 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
4:12.753 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
4:13.872 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
4:14.964 standard D marrowrend Fluffy_Pillow 80.0/125: 64% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), crimson_scourge, resounding_protection, elemental_whirl_haste, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
4:16.060 standard I death_and_decay Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), crimson_scourge, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)
4:17.163 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
4:18.272 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
4:19.385 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), overwhelming_power, archive_of_the_titans(20), critical_prowess(5)
4:20.499 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:21.618 Waiting     1.500 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:23.118 default 6 mind_freeze Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:23.216 Waiting     1.200 sec 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:24.416 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:25.569 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:26.720 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:27.873 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:29.024 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:30.176 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:31.328 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:32.480 standard L rune_strike Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:33.599 Waiting     0.400 sec 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:33.999 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:35.118 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:36.238 standard I death_and_decay Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), crimson_scourge, resounding_protection, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:37.357 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:38.475 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:39.593 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
4:40.709 standard D marrowrend Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, resounding_protection, elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
4:41.829 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 316700.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
4:42.979 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
4:44.131 Waiting     2.900 sec 80.0/125: 64% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
4:47.031 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:48.183 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:49.336 default 6 mind_freeze Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:49.336 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:50.490 standard E death_strike Fluffy_Pillow 95.0/125: 76% runic_power | 316700.0/316700: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:51.640 standard E death_strike Fluffy_Pillow 55.0/125: 44% runic_power | 316700.0/316700: 100% health | 4.0/6: 67% rune blood_shield, bone_shield(5), resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:52.790 standard D marrowrend Fluffy_Pillow 15.0/125: 12% runic_power | 316700.0/316700: 100% health | 4.0/6: 67% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:53.941 standard J blood_boil Fluffy_Pillow 35.0/125: 28% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:55.094 standard K heart_strike Fluffy_Pillow 35.0/125: 28% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:56.245 standard E death_strike Fluffy_Pillow 50.0/125: 40% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:57.397 standard K heart_strike Fluffy_Pillow 10.0/125: 8% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:58.546 Waiting     0.200 sec 25.0/125: 20% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:58.746 standard J blood_boil Fluffy_Pillow 25.0/125: 20% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)

Stats

Level Bonus (120) Race Bonus (undead) Raid-Buffed Unbuffed Gear Amount
Strength 1467 2 5842 5544 4075 (3433)
Agility 1467 -1 1526 1466 0
Stamina 1001 1 15170 13791 7207
Intellect 1467 -2 1677 1465 0
Spirit 0 0 0 0 0
Health 303400 275820 0
Runic Power 125 125 0
Rune 6 6 0
Crit 17.08% 17.08% 870
Haste 18.87% 17.84% 1213
Damage / Heal Versatility 4.69% 4.69% 399
Mitigation Versatility 2.35% 2.35% 399
Attack Power 7562 6524 0
Mastery 35.36% 35.36% 697
Armor 4663 4663 4055
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 6.00% 6.00% 0
Tank-Parry 22.43% 22.00% 870
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 386.00
Local Head Gridrunner Galea
ilevel: 390, stats: { 571 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Azerite Empowered, Incite the Pack, Elemental Whirl, Resounding Protection }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Chitinspine Pauldrons
ilevel: 390, stats: { 527 Armor, +491 StrInt, +892 Sta }
azerite powers: { Azerite Empowered, Archive of the Titans, Overwhelming Power, Runic Barrier }
Local Chest Chestguard of Virulent Mutagens
ilevel: 390, stats: { 702 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Azerite Empowered, Archive of the Titans, Unstable Flames, Resounding Protection }
Local Waist Decontaminator's Greatbelt
ilevel: 385, stats: { 382 Armor, +247 StrInt, +417 Sta, +123 Mastery, +60 Crit }
Local Legs Greaves of Unending Vigil
ilevel: 385, stats: { 594 Armor, +329 StrInt, +556 Sta, +165 Haste, +81 Mastery }
Local Feet Warboots of Absolute Eradication
ilevel: 385, stats: { 467 Armor, +247 StrInt, +417 Sta, +111 Haste, +72 Vers }
Local Wrists Imperious Vambraces
ilevel: 385, stats: { 297 Armor, +185 StrInt, +312 Sta, +83 Vers, +54 Haste }
Local Hands Waste Disposal Crushers
ilevel: 385, stats: { 424 Armor, +247 StrInt, +417 Sta, +115 Crit, +68 Vers }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Syringe of Bloodborne Infirmity
ilevel: 385, stats: { +313 Str }
Local Trinket2 Vanquished Tendril of G'huun
ilevel: 385, stats: { +176 Vers }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Khor, Hammer of the Corrupted
ilevel: 385, weapon: { 778 - 1003, 3.6 }, stats: { +329 Str, +556 Sta, +142 Crit, +103 Haste }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Heartbreaker (Blood Death Knight) Blooddrinker (Blood Death Knight) Rune Strike (Blood Death Knight)
30 Rapid Decomposition (Blood Death Knight) Hemostasis (Blood Death Knight) Consumption (Blood Death Knight)
45 Foul Bulwark (Blood Death Knight) Ossuary (Blood Death Knight) Tombstone (Blood Death Knight)
60 Will of the Necropolis (Blood Death Knight) Anti-Magic Barrier (Blood Death Knight) Rune Tap (Blood Death Knight)
75 Grip of the Dead (Blood Death Knight) Tightening Grasp (Blood Death Knight) Wraith Walk (Blood Death Knight)
90 Voracious (Blood Death Knight) Bloodworms (Blood Death Knight) Mark of Blood (Blood Death Knight)
100 Purgatory (Blood Death Knight) Red Thirst (Blood Death Knight) Bonestorm (Blood Death Knight)

Profile

deathknight="T22_Death_Knight_Blood"
spec=blood
level=120
race=undead
role=tank
position=front
talents=3222022

# Default consumables
potion=battle_potion_of_strength
flask=flask_of_the_undertow
food=swamp_fish_n_chips
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze
actions+=/blood_fury,if=cooldown.dancing_rune_weapon.ready&(!cooldown.blooddrinker.ready|!talent.blooddrinker.enabled)
actions+=/berserking
actions+=/use_items
actions+=/potion,if=buff.dancing_rune_weapon.up
actions+=/dancing_rune_weapon,if=!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
actions+=/tombstone,if=buff.bone_shield.stack>=7
actions+=/call_action_list,name=standard

actions.standard=death_strike,if=runic_power.deficit<=10
actions.standard+=/blooddrinker,if=!buff.dancing_rune_weapon.up
actions.standard+=/marrowrend,if=(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
actions.standard+=/blood_boil,if=charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
actions.standard+=/marrowrend,if=buff.bone_shield.stack<5&talent.ossuary.enabled&runic_power.deficit>=15
actions.standard+=/bonestorm,if=runic_power>=100&!buff.dancing_rune_weapon.up
actions.standard+=/death_strike,if=runic_power.deficit<=(15+buff.dancing_rune_weapon.up*5+spell_targets.heart_strike*talent.heartbreaker.enabled*2)|target.time_to_die<10
actions.standard+=/death_and_decay,if=spell_targets.death_and_decay>=3
actions.standard+=/rune_strike,if=(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
actions.standard+=/heart_strike,if=buff.dancing_rune_weapon.up|rune.time_to_4<gcd
actions.standard+=/blood_boil,if=buff.dancing_rune_weapon.up
actions.standard+=/death_and_decay,if=buff.crimson_scourge.up|talent.rapid_decomposition.enabled|spell_targets.death_and_decay>=2
actions.standard+=/consumption
actions.standard+=/blood_boil
actions.standard+=/heart_strike,if=rune.time_to_3<gcd|buff.bone_shield.stack>6
actions.standard+=/rune_strike
actions.standard+=/arcane_torrent,if=runic_power.deficit>20

head=gridrunner_galea,id=160634,bonus_id=4824/1507/4775,azerite_powers=13/481/21/15
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=chitinspine_pauldrons,id=160641,bonus_id=4824/1507/4775,azerite_powers=13/483/30/201
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chestguard_of_virulent_mutagens,id=160636,bonus_id=4824/1507/4775,azerite_powers=13/483/459/15
wrists=imperious_vambraces,id=160723,bonus_id=4800/1507
hands=waste_disposal_crushers,id=160635,bonus_id=4800/1507
waist=decontaminators_greatbelt,id=160638,bonus_id=4800/1507
legs=greaves_of_unending_vigil,id=160639,bonus_id=4800/1507
feet=warboots_of_absolute_eradication,id=160640,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=syringe_of_bloodborne_infirmity,id=160655,bonus_id=4800/1507
trinket2=vanquished_tendril_of_ghuun,id=160654,bonus_id=4800/1507
main_hand=khor_hammer_of_the_corrupted,id=160679,bonus_id=4800/1507,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=386.27
# gear_strength=4075
# gear_stamina=7207
# gear_crit_rating=870
# gear_haste_rating=1213
# gear_mastery_rating=697
# gear_versatility_rating=399
# gear_armor=4055

T22_Priest_Shadow : 13728 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13728.1 13728.1 7.6 / 0.055% 1300.1 / 9.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 43.4 100.0% 100%
Talents
  • 15: Shadow Word: Void (Shadow Priest)
  • 30: Body and Soul
  • 45: Twist of Fate (Shadow Priest)
  • 60: Last Word (Shadow Priest)
  • 75: Shadow Crash (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Dark Ascension (Shadow Priest)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Priest_Shadow 13728
Dark Ascension 0 (456) 0.0% (3.3%) 5.5 60.39sec 24893 20766

Stats details: dark_ascension

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1988 0.0000 0.00 0.00 0.00 20765.75 20765.75
 
 

Action details: dark_ascension

Static Values
  • id:280711
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.voidform.down
Spelldata
  • id:280711
  • name:Dark Ascension
  • school:shadow
  • tooltip:
  • description:Immediately activates a new Voidform, then releases an explosive blast of pure void energy, causing ${{$280800s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. |cFFFFFFFFGenerates ${{$s2=5000}/100} Insanity.|r
 
    Dark Ascension (_damage) 456 3.3% 5.5 60.39sec 24893 0 Direct 10.9 8589 25583 12480 22.9%  

Stats details: dark_ascension_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 10.90 0.00 0.00 0.0000 0.0000 136098.71 136098.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.41 77.10% 8589.28 7803 10783 8588.49 0 10783 72213 72213 0.00
crit 2.50 22.90% 25583.42 15606 43131 19361.94 0 32348 63886 63886 0.00
 
 

Action details: dark_ascension_damage

Static Values
  • id:280800
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:27.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:280800
  • name:Dark Ascension
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280711=Immediately activates a new Voidform, then releases an explosive blast of pure void energy, causing ${{$280800s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. |cFFFFFFFFGenerates ${{$s2=5000}/100} Insanity.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 144 (206) 1.0% (1.5%) 7.4 37.27sec 8390 0 Direct 7.4 4823 9649 5871 21.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.35 7.35 0.00 0.00 0.0000 0.0000 43175.48 43175.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.76 78.30% 4823.16 4714 5185 4819.76 0 5185 27774 27774 0.00
crit 1.60 21.70% 9648.62 9427 10370 7796.90 0 10370 15401 15401 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4422.00
  • base_dd_max:4422.00
 
    Heed My Call (_aoe) 62 0.5% 7.4 37.27sec 2519 0 Direct 7.4 2067 4135 2519 21.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.35 7.35 0.00 0.00 0.0000 0.0000 18528.27 18528.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.75 78.13% 2066.93 2020 2222 2064.37 0 2222 11876 11876 0.00
crit 1.61 21.87% 4134.72 4040 4444 3341.85 0 4444 6652 6652 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1895.00
  • base_dd_max:1895.00
 
Shadow Word: Void (mind_blast) 2556 18.6% 49.2 5.99sec 15561 13536 Direct 50.2 12460 24808 15251 22.6%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.21 50.21 0.00 0.00 1.1496 0.0000 765792.16 765792.16 0.00 13536.35 13536.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.86 77.39% 12459.65 11442 15680 12463.79 12054 13036 484195 484195 0.00
crit 11.35 22.61% 24808.00 22885 31361 24812.50 22962 27744 281597 281597 0.00
 
 

Action details: mind_blast

Static Values
  • id:205351
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205351
  • name:Shadow Word: Void
  • school:shadow
  • tooltip:
  • description:Blasts the target with a word of void for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 2444 17.8% 76.2 3.83sec 9614 6342 Periodic 198.1 3018 6001 3698 22.8% 37.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.21 0.00 198.15 198.15 1.5160 0.5717 732681.87 732681.87 0.00 6341.53 6341.53
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.0 77.20% 3017.54 2772 3831 3018.27 2935 3148 461623 461623 0.00
crit 45.2 22.80% 6000.96 5544 7661 6001.78 5726 6360 271059 271059 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=50}%.$?a185916[ |cFFFFFFFFGenerates ${{$s4=4}*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.337500
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Crash 0 (546) 0.0% (4.0%) 14.8 20.76sec 11049 9518

Stats details: shadow_crash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.81 0.00 0.00 0.00 1.1608 0.0000 0.00 0.00 0.00 9518.09 9518.09
 
 

Action details: shadow_crash

Static Values
  • id:205385
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:1.5000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:raid_event.adds.in>5&raid_event.adds.duration<20
Spelldata
  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within $205386A1 yards. |cFFFFFFFFGenerates {$/100;s2=20} Insanity.|r
 
    Shadow Crash (_damage) 546 4.0% 14.7 20.76sec 11107 0 Direct 14.7 9156 18246 11107 21.5%  

Stats details: shadow_crash_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.73 14.73 0.00 0.00 0.0000 0.0000 163596.91 163596.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.57 78.54% 9156.28 8418 11632 9158.93 8598 10000 105930 105930 0.00
crit 3.16 21.46% 18245.70 16835 23264 17717.80 0 23264 57667 57667 0.00
 
 

Action details: shadow_crash_damage

Static Values
  • id:205386
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within $205386A1 yards. |cFFFFFFFFGenerates {$/100;s2=20} Insanity.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Pain 1548 11.3% 7.5 41.40sec 71710 61286 Direct 7.5 1977 3949 2408 21.8%  
Periodic 192.4 1901 3789 2317 22.0% 98.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 192.40 192.40 1.1702 1.5312 463963.65 463963.65 0.00 1780.59 61286.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.89 78.16% 1976.74 1807 2497 1978.13 1810 2275 11640 11640 0.00
crit 1.65 21.84% 3949.07 3614 4994 3294.92 0 4994 6498 6498 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 150.0 77.97% 1901.40 2 2359 1901.89 1851 1994 285220 285220 0.00
crit 42.4 22.03% 3788.62 4 4719 3789.22 3594 4032 160606 160606 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=0} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=16 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.220000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Shadowy Apparitions 0 (255) 0.0% (1.9%) 42.4 6.86sec 1799 0

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
 
        Shadowy Apparition 255 1.9% 41.8 6.84sec 1824 0 Direct 41.8 1824 0 1824 0.0%  

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.81 41.81 0.00 0.00 0.0000 0.0000 76273.82 76273.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.81 100.00% 1824.47 1684 2326 1824.85 1740 1938 76274 76274 0.00
 
 

Action details: shadowy_apparition

Static Values
  • id:148859
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 1271 9.3% 5.9 54.19sec 65129 56564 Periodic 127.1 2460 4898 2999 22.1% 97.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.85 0.00 127.07 127.07 1.1515 2.3031 381013.66 381013.66 0.00 1272.64 56563.79
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.0 77.92% 2460.21 8 3121 2460.99 2382 2572 243585 243585 0.00
crit 28.1 22.08% 4898.27 286 6243 4899.35 4636 5270 137428 137428 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(target.time_to_die>6)
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=21 seconds}, and heals you for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.275000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 2770 20.2% 63.8 4.70sec 13008 11493 Direct 63.7 10803 21553 13035 20.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.78 63.65 0.00 0.00 1.1318 0.0000 829715.18 829715.18 0.00 11493.33 11493.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.43 79.23% 10802.62 9856 13620 10806.80 10470 11355 544785 544785 0.00
crit 13.22 20.77% 21553.23 19713 27241 21556.48 19900 24130 284931 284931 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dark_void.enabled&dot.shadow_word_pain.remains>travel_time
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=0} Shadow damage$?a231688[ and extending the duration of Shadow Word: Pain and Vampiric Touch on all nearby targets by ${{$231688s1=3000}/1000}.1 sec][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Void Eruption 0 (389) 0.0% (2.8%) 4.9 60.06sec 24076 12064

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.85 0.00 0.00 0.00 1.9959 0.0000 0.00 0.00 0.00 12063.62 12063.62
 
 

Action details: void_eruption

Static Values
  • id:228260
  • school:shadow
  • resource:insanity
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • cooldown hasted:true
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228260
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:Releases an explosive blast of pure void energy, activating Voidform and causing ${{$228360s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r
 
    Void Eruption (_damage) 389 2.8% 4.9 60.06sec 24076 0 Direct 9.7 8389 25033 12068 22.1%  

Stats details: void_eruption_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.85 9.68 0.00 0.00 0.0000 0.0000 116872.35 116872.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.54 77.89% 8388.61 7803 10783 8377.41 0 10757 63276 63276 0.00
crit 2.14 22.11% 25032.72 15606 43131 17425.96 0 32348 53596 53596 0.00
 
 

Action details: void_eruption_damage

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing ${{$228360s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mindbender 4866 / 1288
melee 4866 9.4% 69.9 4.05sec 5516 5045 Direct 69.9 4589 9174 5516 20.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.89 69.89 0.00 0.00 1.0933 0.0000 385497.63 385497.63 0.00 5045.05 5045.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.77 79.79% 4589.31 4377 4999 4592.06 4488 4734 255935 255935 0.00
crit 14.12 20.21% 9173.86 8754 9998 9179.30 8780 9855 129562 129562 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Priest_Shadow
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
Berserking 2.0 0.00sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
Mindbender 5.4 60.67sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 0.00 0.00 0.00 1.1342 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates ${{$200010s1=600}/100} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Potion of Intellect 2.0 0.0 195.8sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 0.0sec 6.76% 7.07% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
chorus_of_insanity 9.6 0.0 30.0sec 30.0sec 22.65% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_chorus_of_insanity
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:crit_rating
  • amount:48.00

Stack Uptimes

  • chorus_of_insanity_1:0.90%
  • chorus_of_insanity_2:1.05%
  • chorus_of_insanity_3:0.88%
  • chorus_of_insanity_4:1.04%
  • chorus_of_insanity_5:0.91%
  • chorus_of_insanity_6:1.05%
  • chorus_of_insanity_7:0.87%
  • chorus_of_insanity_8:1.05%
  • chorus_of_insanity_9:0.92%
  • chorus_of_insanity_10:1.04%
  • chorus_of_insanity_11:0.87%
  • chorus_of_insanity_12:1.04%
  • chorus_of_insanity_13:0.91%
  • chorus_of_insanity_14:1.05%
  • chorus_of_insanity_15:0.88%
  • chorus_of_insanity_16:1.04%
  • chorus_of_insanity_17:0.91%
  • chorus_of_insanity_18:1.05%
  • chorus_of_insanity_19:0.88%
  • chorus_of_insanity_20:1.04%
  • chorus_of_insanity_21:0.75%
  • chorus_of_insanity_22:0.60%
  • chorus_of_insanity_23:0.58%
  • chorus_of_insanity_24:0.39%
  • chorus_of_insanity_25:0.34%
  • chorus_of_insanity_26:0.34%
  • chorus_of_insanity_27:0.28%
  • chorus_of_insanity_28:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
insanity_drain_stacks 10.3 212.1 30.5sec 29.6sec 72.30% 0.00% 212.1(212.1) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • insanity_drain_stacks_1:72.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Overwhelming Power 4.9 0.0 59.8sec 37.7sec 37.59% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:24.00

Stack Uptimes

  • overwhelming_power_1:1.47%
  • overwhelming_power_2:1.48%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.49%
  • overwhelming_power_6:1.50%
  • overwhelming_power_7:1.50%
  • overwhelming_power_8:1.51%
  • overwhelming_power_9:1.51%
  • overwhelming_power_10:1.52%
  • overwhelming_power_11:1.52%
  • overwhelming_power_12:1.53%
  • overwhelming_power_13:1.53%
  • overwhelming_power_14:1.54%
  • overwhelming_power_15:1.54%
  • overwhelming_power_16:1.55%
  • overwhelming_power_17:1.55%
  • overwhelming_power_18:1.56%
  • overwhelming_power_19:1.56%
  • overwhelming_power_20:1.57%
  • overwhelming_power_21:1.57%
  • overwhelming_power_22:1.57%
  • overwhelming_power_23:1.59%
  • overwhelming_power_24:1.62%
  • overwhelming_power_25:0.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Shadowform 10.6 0.0 29.6sec 30.0sec 27.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadowform_1:27.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.4 1.2 61.3sec 45.7sec 24.36% 0.00% 1.2(1.2) 4.2

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:24.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 137.7 0.0sec 0.7sec 34.71% 0.00% 137.7(137.7) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • twist_of_fate_1:34.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:123254
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$s1=10}%.
  • description:{$@spelldesc109142=After damaging a target below {$s1=35}% health, you gain {$123254s2=10}% increased damage and healing for {$123254d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging a target below {$s1=35}% health, you gain {$123254s2=10}% increased damage and healing for {$123254d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Voidform 10.3 0.0 30.5sec 29.6sec 72.30% 67.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • voidform_1:3.44%
  • voidform_2:3.43%
  • voidform_3:3.42%
  • voidform_4:3.41%
  • voidform_5:3.39%
  • voidform_6:3.38%
  • voidform_7:3.37%
  • voidform_8:3.36%
  • voidform_9:3.35%
  • voidform_10:3.34%
  • voidform_11:3.32%
  • voidform_12:3.31%
  • voidform_13:3.30%
  • voidform_14:3.29%
  • voidform_15:3.28%
  • voidform_16:3.27%
  • voidform_17:3.26%
  • voidform_18:3.25%
  • voidform_19:3.22%
  • voidform_20:2.81%
  • voidform_21:1.93%
  • voidform_22:1.69%
  • voidform_23:1.18%
  • voidform_24:0.52%
  • voidform_25:0.36%
  • voidform_26:0.34%
  • voidform_27:0.08%
  • voidform_28:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:{$?s205351=false}[Shadow Word: Void][Mind Blast] cooldown reduced by ${$w6/1000}.1 sec. Spell damage dealt increased by $w1%. Haste increased by ${$W4}.1%. Losing ${$w3/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing spell damage you deal by {$194249s1=10}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000}.1 sec,][] and granting an additional ${{$s2=5}/10}.1% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Whispers of the Damned 1.0 62.8 0.0sec 4.7sec 99.63% 0.00% 62.8(62.8) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_whispers_of_the_damned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • whispers_of_the_damned_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:275725
  • name:Whispers of the Damned
  • tooltip:
  • description:{$@spelldesc275722=Void Bolt increases the damage of {$?s205351=false}[Shadow Word: Void][Mind Blast] by {$s1=375} for {$275726d=6 seconds}, stacking up to 6 times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthlink

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_earthlink
  • max_stacks:6
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:19.00

Stack Uptimes

  • earthlink_1:16.67%
  • earthlink_2:16.67%
  • earthlink_3:16.67%
  • earthlink_4:16.67%
  • earthlink_5:16.67%
  • earthlink_6:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279928
  • name:Earthlink
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by $w1.
  • description:{$@spelldesc279926=Azerite energy courses through you, reaching ${{$s1=9}*6} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] and then diminishing down to {$s1=9} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat], cycling every 6 sec.}
  • max_stacks:6
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 42.4 6.8sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Priest_Shadow
Resource RPS-Gain RPS-Loss
Insanity 10.35 10.13
Combat End Resource Mean Min Max
Mana 19999.00 19999.00 19999.00
Insanity 63.79 0.18 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T22_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Priest_Shadow Damage Per Second
Count 7499
Mean 13728.15
Minimum 12722.52
Maximum 14936.38
Spread ( max - min ) 2213.85
Range [ ( max - min ) / 2 * 100% ] 8.06%
Standard Deviation 335.3309
5th Percentile 13214.56
95th Percentile 14309.92
( 95th Percentile - 5th Percentile ) 1095.36
Mean Distribution
Standard Deviation 3.8723
95.00% Confidence Intervall ( 13720.56 - 13735.73 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2293
0.1 Scale Factor Error with Delta=300 960
0.05 Scale Factor Error with Delta=300 3840
0.01 Scale Factor Error with Delta=300 95992
Priority Target DPS
Sample Data T22_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 13728.15
Minimum 12722.52
Maximum 14936.38
Spread ( max - min ) 2213.85
Range [ ( max - min ) / 2 * 100% ] 8.06%
Standard Deviation 335.3309
5th Percentile 13214.56
95th Percentile 14309.92
( 95th Percentile - 5th Percentile ) 1095.36
Mean Distribution
Standard Deviation 3.8723
95.00% Confidence Intervall ( 13720.56 - 13735.73 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2293
0.1 Scale Factor Error with Delta=300 960
0.05 Scale Factor Error with Delta=300 3840
0.01 Scale Factor Error with Delta=300 95992
DPS(e)
Sample Data T22_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 13728.15
Minimum 12722.52
Maximum 14936.38
Spread ( max - min ) 2213.85
Range [ ( max - min ) / 2 * 100% ] 8.06%
Damage
Sample Data T22_Priest_Shadow Damage
Count 7499
Mean 3727712.05
Minimum 2868042.90
Maximum 4686080.60
Spread ( max - min ) 1818037.70
Range [ ( max - min ) / 2 * 100% ] 24.39%
DTPS
Sample Data T22_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
7 0.00 shadow_word_void
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=80|target.health.pct<35
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
9 2.00 berserking
A 0.00 run_action_list,name=aoe,if=spell_targets.mind_sear>(5+1*talent.misery.enabled)
B 0.00 run_action_list,name=cleave,if=active_enemies>1
C 0.00 run_action_list,name=single,if=active_enemies=1
actions.single
# count action,conditions
D 4.89 void_eruption
E 5.47 dark_ascension,if=buff.voidform.down
F 63.79 void_bolt
0.00 shadow_word_death,if=target.time_to_die<3|cooldown.shadow_word_death.charges=2|(cooldown.shadow_word_death.charges=1&cooldown.shadow_word_death.remains<gcd.max)
0.00 surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)&target.time_to_die>200|target.time_to_die<75
0.00 dark_void,if=raid_event.adds.in>10
G 5.42 mindbender
0.00 shadow_word_death,if=!buff.voidform.up|(cooldown.shadow_word_death.charges=2&buff.voidform.stack<15)
H 14.81 shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
I 49.39 mind_blast,if=variable.dots_up
0.00 void_torrent,if=dot.shadow_word_pain.remains>4&dot.vampiric_touch.remains>4
J 7.53 shadow_word_pain,if=refreshable&target.time_to_die>4&!talent.misery.enabled&!talent.dark_void.enabled
K 5.85 vampiric_touch,if=refreshable&target.time_to_die>6|(talent.misery.enabled&dot.shadow_word_pain.refreshable)
L 56.97 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
0.00 shadow_word_pain

Sample Sequence

0124569EFGHFJKFIIFLFILFLFILFILFHLFILILIDFLFHIFLIFLFIJFLEFGHFIIFLFIKFLFILHILJDFILFILFHLFILFLIFLIKEFGHFILFLIFLFILFLIHJLILDFILFLFHIFLIFKJFIL9EFGIFHIFLFI8LFLFILIHLJLIDFKLFILFLHFILFILFLILEFGIFHLFILFLIFLFIJLHILKDFILFLIFLFHIFLIL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 1 food T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 2 augmentation T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 4 potion Fluffy_Pillow 19999.0/19999: 100% mana | 0.0/100: 0% insanity battle_potion_of_intellect
Pre precombat 5 shadowform Fluffy_Pillow 19999.0/19999: 100% mana | 0.0/100: 0% insanity battle_potion_of_intellect
0:00.000 precombat 6 mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity battle_potion_of_intellect
0:00.000 default 9 berserking Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity battle_potion_of_intellect
0:00.000 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity berserking, battle_potion_of_intellect
0:01.109 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 58.3/100: 58% insanity bloodlust, berserking, torrent_of_elements, battle_potion_of_intellect
0:01.956 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 68.5/100: 68% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:02.801 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 68.1/100: 68% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:03.645 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.2/100: 87% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:04.485 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 98.6/100: 99% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:05.320 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:06.152 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:06.979 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 97.1/100: 97% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:07.806 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:08.630 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:09.448 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 95.5/100: 95% insanity bloodlust, berserking, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:11.593 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 92.4/100: 92% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:12.521 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 91.8/100: 92% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:13.445 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:14.364 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.7/100: 95% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:15.279 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.0/100: 90% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:17.320 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 76.0/100: 76% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:18.220 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 74.2/100: 74% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:19.119 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 70.7/100: 71% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:20.012 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 57.8/100: 58% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:20.901 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 54.2/100: 54% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:22.012 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 44.0/100: 44% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:22.894 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 29.2/100: 29% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:23.778 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 23.7/100: 24% insanity bloodlust, whispers_of_the_damned
0:24.656 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 21.7/100: 22% insanity bloodlust, whispers_of_the_damned
0:25.530 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 5.3/100: 5% insanity bloodlust, whispers_of_the_damned
0:26.399 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 3.6/100: 4% insanity bloodlust, shadowform, chorus_of_insanity(27), whispers_of_the_damned
0:27.382 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 18.6/100: 19% insanity bloodlust, shadowform, chorus_of_insanity(26), whispers_of_the_damned, torrent_of_elements
0:30.320 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 36.6/100: 37% insanity bloodlust, shadowform, chorus_of_insanity(24), whispers_of_the_damned, torrent_of_elements
0:31.303 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 51.6/100: 52% insanity bloodlust, shadowform, chorus_of_insanity(23), whispers_of_the_damned, torrent_of_elements
0:36.199 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 81.6/100: 82% insanity bloodlust, shadowform, chorus_of_insanity(18), whispers_of_the_damned, torrent_of_elements
0:37.182 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 96.6/100: 97% insanity bloodlust, shadowform, chorus_of_insanity(17), whispers_of_the_damned, torrent_of_elements
0:38.817 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 96.5/100: 97% insanity bloodlust, voidform, insanity_drain_stacks, chorus_of_insanity(15), whispers_of_the_damned, torrent_of_elements
0:39.796 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 94.1/100: 94% insanity bloodlust, voidform, insanity_drain_stacks, chorus_of_insanity(14), whispers_of_the_damned, torrent_of_elements
0:42.513 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 88.7/100: 89% insanity voidform(4), insanity_drain_stacks, chorus_of_insanity(11), whispers_of_the_damned
0:43.764 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 88.7/100: 89% insanity voidform(5), insanity_drain_stacks, chorus_of_insanity(10), whispers_of_the_damned
0:45.022 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 87.4/100: 87% insanity voidform(7), insanity_drain_stacks, chorus_of_insanity(9), whispers_of_the_damned
0:46.257 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 88.7/100: 89% insanity voidform(8), insanity_drain_stacks, chorus_of_insanity(8), whispers_of_the_damned
0:47.485 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 85.2/100: 85% insanity voidform(9), insanity_drain_stacks, chorus_of_insanity(6), whispers_of_the_damned, torrent_of_elements
0:48.707 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 75.3/100: 75% insanity voidform(10), insanity_drain_stacks, chorus_of_insanity(5), whispers_of_the_damned, torrent_of_elements
0:49.923 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 73.3/100: 73% insanity voidform(12), insanity_drain_stacks, chorus_of_insanity(4), whispers_of_the_damned, torrent_of_elements
0:51.126 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 71.3/100: 71% insanity voidform(13), insanity_drain_stacks, chorus_of_insanity(3), whispers_of_the_damned, torrent_of_elements
0:53.792 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 39.3/100: 39% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
0:54.982 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 33.8/100: 34% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
0:56.158 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 26.4/100: 26% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
0:57.330 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 7.0/100: 7% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
0:58.495 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 9.1/100: 9% insanity shadowform, chorus_of_insanity(20), whispers_of_the_damned, torrent_of_elements
1:00.408 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 18.1/100: 18% insanity shadowform, chorus_of_insanity(17), whispers_of_the_damned, torrent_of_elements
1:01.684 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 60.2/100: 60% insanity voidform(2), insanity_drain_stacks, chorus_of_insanity(14), whispers_of_the_damned, torrent_of_elements
1:02.947 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 67.2/100: 67% insanity voidform(3), insanity_drain_stacks, chorus_of_insanity(12), whispers_of_the_damned
1:04.204 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 63.0/100: 63% insanity voidform(4), insanity_drain_stacks, chorus_of_insanity(10), whispers_of_the_damned
1:05.456 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 77.6/100: 78% insanity voidform(6), insanity_drain_stacks, chorus_of_insanity(6), whispers_of_the_damned
1:06.695 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 87.0/100: 87% insanity voidform(7), insanity_drain_stacks, chorus_of_insanity(4), whispers_of_the_damned
1:07.929 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 94.2/100: 94% insanity voidform(8), insanity_drain_stacks, chorus_of_insanity(2), whispers_of_the_damned
1:09.156 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned
1:10.377 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.1/100: 90% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned
1:13.062 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 74.7/100: 75% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
1:14.261 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 77.3/100: 77% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
1:15.455 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 77.8/100: 78% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned
1:16.637 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 68.4/100: 68% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned
1:17.813 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 67.9/100: 68% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned
1:20.367 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 27.5/100: 28% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned
1:21.528 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 17.9/100: 18% insanity voidform(22), insanity_drain_stacks, whispers_of_the_damned
1:22.678 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 17.3/100: 17% insanity shadowform, chorus_of_insanity(20), whispers_of_the_damned
1:24.591 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 26.3/100: 26% insanity shadowform, chorus_of_insanity(14), whispers_of_the_damned
1:25.867 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 46.3/100: 46% insanity shadowform, chorus_of_insanity(11), whispers_of_the_damned
1:27.185 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 61.3/100: 61% insanity shadowform, chorus_of_insanity(8), whispers_of_the_damned
1:32.912 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 88.3/100: 88% insanity shadowform, whispers_of_the_damned
1:34.188 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 92.3/100: 92% insanity shadowform, whispers_of_the_damned
1:36.313 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 92.3/100: 92% insanity voidform, insanity_drain_stacks, whispers_of_the_damned
1:37.582 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity voidform(2), insanity_drain_stacks, whispers_of_the_damned
1:38.844 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.2/100: 98% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned
1:40.101 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.0/100: 94% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned
1:41.352 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 88.6/100: 89% insanity voidform(6), insanity_drain_stacks, whispers_of_the_damned
1:42.592 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 91.0/100: 91% insanity voidform(7), insanity_drain_stacks, whispers_of_the_damned
1:43.824 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 83.3/100: 83% insanity voidform(8), insanity_drain_stacks, whispers_of_the_damned
1:45.054 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 84.4/100: 84% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned
1:46.275 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.1/100: 84% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned
1:47.491 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 72.9/100: 73% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
1:48.696 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 70.8/100: 71% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
1:49.896 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 66.6/100: 67% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(25)
1:51.005 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 53.9/100: 54% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(23)
1:52.116 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 50.1/100: 50% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(22)
1:53.224 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 35.4/100: 35% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(21)
1:54.332 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 28.8/100: 29% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(20)
1:55.432 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 22.2/100: 22% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(19)
1:58.832 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 13.6/100: 14% insanity shadowform, chorus_of_insanity(13), whispers_of_the_damned, torrent_of_elements, overwhelming_power(16)
2:00.052 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 28.6/100: 29% insanity shadowform, chorus_of_insanity(9), whispers_of_the_damned, torrent_of_elements, overwhelming_power(14)
2:01.278 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 34.6/100: 35% insanity shadowform, chorus_of_insanity(5), whispers_of_the_damned, torrent_of_elements, overwhelming_power(13)
2:02.506 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 77.1/100: 77% insanity voidform(2), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(12)
2:03.726 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 84.4/100: 84% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(11)
2:04.942 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 80.7/100: 81% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(10)
2:06.273 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.7/100: 95% insanity voidform(5), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(8)
2:07.489 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 93.7/100: 94% insanity voidform(7), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(7)
2:08.696 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity voidform(8), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(6)
2:09.899 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 97.5/100: 98% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(5)
2:11.102 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.4/100: 90% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(2)
2:12.311 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 85.6/100: 86% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power
2:13.510 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 88.7/100: 89% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
2:14.709 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 87.0/100: 87% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
2:17.678 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 61.9/100: 62% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned
2:18.854 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 61.3/100: 61% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned
2:20.026 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 52.8/100: 53% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned
2:21.191 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 34.3/100: 34% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned
2:22.352 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 24.7/100: 25% insanity voidform(22), insanity_drain_stacks, whispers_of_the_damned
2:24.075 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 7.4/100: 7% insanity shadowform, chorus_of_insanity(22), whispers_of_the_damned
2:25.350 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 22.4/100: 22% insanity shadowform, chorus_of_insanity(15), whispers_of_the_damned
2:26.625 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 42.4/100: 42% insanity shadowform, chorus_of_insanity(9), whispers_of_the_damned
2:27.903 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 46.4/100: 46% insanity shadowform, chorus_of_insanity(2), whispers_of_the_damned
2:29.815 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 55.4/100: 55% insanity shadowform, whispers_of_the_damned
2:31.226 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 70.4/100: 70% insanity shadowform, whispers_of_the_damned
2:35.682 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 91.4/100: 91% insanity shadowform, whispers_of_the_damned
2:37.808 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 91.4/100: 91% insanity voidform, insanity_drain_stacks, whispers_of_the_damned
2:39.077 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity voidform(2), insanity_drain_stacks, whispers_of_the_damned
2:40.341 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned
2:41.600 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 93.9/100: 94% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned
2:42.852 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.6/100: 89% insanity voidform(6), insanity_drain_stacks, whispers_of_the_damned
2:45.936 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 70.0/100: 70% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned
2:47.157 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 70.6/100: 71% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned
2:48.373 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 74.1/100: 74% insanity voidform(11), insanity_drain_stacks, whispers_of_the_damned
2:49.583 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 71.5/100: 72% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
2:50.787 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 68.9/100: 69% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
2:51.986 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 55.1/100: 55% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned
2:53.174 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 49.4/100: 49% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned
2:54.357 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 43.7/100: 44% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned
2:55.534 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 27.0/100: 27% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned
2:56.705 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 7.3/100: 7% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned
2:57.871 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 0.1/100: 0% insanity shadowform, chorus_of_insanity(21), whispers_of_the_damned
2:59.147 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 15.1/100: 15% insanity shadowform, chorus_of_insanity(15), whispers_of_the_damned
3:01.059 default 9 berserking Fluffy_Pillow 19999.0/19999: 100% mana | 24.1/100: 24% insanity shadowform, chorus_of_insanity(3), whispers_of_the_damned
3:01.059 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 24.1/100: 24% insanity berserking, shadowform, chorus_of_insanity(3), whispers_of_the_damned
3:02.387 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 67.4/100: 67% insanity berserking, voidform(2), insanity_drain_stacks, whispers_of_the_damned
3:03.488 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 75.7/100: 76% insanity berserking, voidform(3), insanity_drain_stacks, whispers_of_the_damned
3:04.821 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 71.1/100: 71% insanity berserking, voidform(4), insanity_drain_stacks, whispers_of_the_damned
3:05.911 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 82.5/100: 82% insanity berserking, voidform(5), insanity_drain_stacks, whispers_of_the_damned
3:06.995 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 93.9/100: 94% insanity berserking, voidform(6), insanity_drain_stacks, whispers_of_the_damned
3:08.235 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 94.5/100: 94% insanity berserking, voidform(7), insanity_drain_stacks, whispers_of_the_damned
3:09.401 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity berserking, voidform(9), insanity_drain_stacks, whispers_of_the_damned
3:10.463 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 92.7/100: 93% insanity berserking, voidform(10), insanity_drain_stacks, whispers_of_the_damned
3:13.249 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 80.6/100: 81% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
3:14.452 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 83.7/100: 84% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
3:15.646 default 8 potion Fluffy_Pillow 19999.0/19999: 100% mana | 84.8/100: 85% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned
3:15.646 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.8/100: 85% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:16.835 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 75.9/100: 76% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:18.019 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 76.0/100: 76% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:20.705 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 40.1/100: 40% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:21.864 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 31.0/100: 31% insanity twist_of_fate, voidform(21), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:23.020 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 20.0/100: 20% insanity twist_of_fate, voidform(22), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:26.017 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 21.7/100: 22% insanity twist_of_fate, shadowform, chorus_of_insanity(9), whispers_of_the_damned, battle_potion_of_intellect
3:27.294 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 36.7/100: 37% insanity twist_of_fate, shadowform, chorus_of_insanity(2), whispers_of_the_damned, battle_potion_of_intellect
3:28.571 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 56.7/100: 57% insanity twist_of_fate, shadowform, whispers_of_the_damned, battle_potion_of_intellect
3:31.754 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 71.7/100: 72% insanity twist_of_fate, shadowform, whispers_of_the_damned, battle_potion_of_intellect
3:33.029 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 75.7/100: 76% insanity twist_of_fate, shadowform, whispers_of_the_damned, battle_potion_of_intellect
3:34.307 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 81.7/100: 82% insanity twist_of_fate, shadowform, whispers_of_the_damned, battle_potion_of_intellect
3:35.584 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 96.7/100: 97% insanity twist_of_fate, shadowform, whispers_of_the_damned, battle_potion_of_intellect
3:37.709 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 96.7/100: 97% insanity twist_of_fate, voidform, insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:38.978 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:40.240 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 89.2/100: 89% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(25), battle_potion_of_intellect
3:41.410 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 85.7/100: 86% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(24)
3:42.577 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 89.5/100: 89% insanity twist_of_fate, voidform(5), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(23)
3:43.743 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 92.9/100: 93% insanity twist_of_fate, voidform(7), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(22)
3:44.901 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 86.2/100: 86% insanity twist_of_fate, voidform(8), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(21)
3:46.057 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 86.3/100: 86% insanity twist_of_fate, voidform(9), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(19)
3:47.212 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 77.6/100: 78% insanity twist_of_fate, voidform(10), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(18)
3:48.447 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 80.7/100: 81% insanity twist_of_fate, voidform(11), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(17)
3:49.599 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 79.8/100: 80% insanity twist_of_fate, voidform(12), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(16)
3:50.748 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 77.0/100: 77% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(15)
3:51.889 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 64.1/100: 64% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(13)
3:53.033 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 60.2/100: 60% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(11)
3:54.178 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 54.2/100: 54% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(10)
3:55.320 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 38.2/100: 38% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(9)
3:56.460 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 31.3/100: 31% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(8)
3:58.166 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 3.9/100: 4% insanity twist_of_fate, voidform(21), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(6)
3:59.302 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 18.9/100: 19% insanity twist_of_fate, shadowform, chorus_of_insanity(16), whispers_of_the_damned, torrent_of_elements, overwhelming_power(5)
4:01.186 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 27.9/100: 28% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements, overwhelming_power(3)
4:02.542 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 70.1/100: 70% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(2)
4:03.799 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 77.2/100: 77% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power
4:05.052 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 73.0/100: 73% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:06.304 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 82.7/100: 83% insanity twist_of_fate, voidform(6), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:07.544 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 92.0/100: 92% insanity twist_of_fate, voidform(7), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:08.777 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 92.3/100: 92% insanity twist_of_fate, voidform(8), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:10.004 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 89.5/100: 89% insanity twist_of_fate, voidform(9), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:11.226 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 90.1/100: 90% insanity twist_of_fate, voidform(10), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:12.443 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 94.0/100: 94% insanity twist_of_fate, voidform(12), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:13.646 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.9/100: 88% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned
4:14.844 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 86.9/100: 87% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned
4:16.630 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 71.2/100: 71% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned
4:17.811 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 70.5/100: 71% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned
4:18.987 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 69.8/100: 70% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned
4:21.544 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 28.7/100: 29% insanity twist_of_fate, voidform(21), insanity_drain_stacks, whispers_of_the_damned
4:22.700 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 18.9/100: 19% insanity twist_of_fate, voidform(22), insanity_drain_stacks, whispers_of_the_damned
4:23.851 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 20.5/100: 20% insanity twist_of_fate, shadowform, chorus_of_insanity(20), whispers_of_the_damned
4:25.128 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 24.5/100: 24% insanity twist_of_fate, shadowform, chorus_of_insanity(10), whispers_of_the_damned
4:28.313 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 39.5/100: 39% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:29.591 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 59.5/100: 59% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:30.867 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 74.5/100: 74% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:34.050 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 89.5/100: 89% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:35.325 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 95.5/100: 95% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:37.449 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.4/100: 95% insanity twist_of_fate, voidform, insanity_drain_stacks, whispers_of_the_damned
4:38.718 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned
4:39.981 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.2/100: 98% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned
4:41.238 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.0/100: 94% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned
4:42.489 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.6/100: 89% insanity twist_of_fate, voidform(6), insanity_drain_stacks, whispers_of_the_damned
4:43.728 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 82.0/100: 82% insanity twist_of_fate, voidform(7), insanity_drain_stacks, whispers_of_the_damned
4:44.963 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 83.3/100: 83% insanity twist_of_fate, voidform(8), insanity_drain_stacks, whispers_of_the_damned
4:46.190 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.4/100: 84% insanity twist_of_fate, voidform(9), insanity_drain_stacks, whispers_of_the_damned
4:49.229 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 57.5/100: 57% insanity twist_of_fate, voidform(12), insanity_drain_stacks, whispers_of_the_damned
4:50.433 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 54.8/100: 55% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned
4:51.634 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 55.0/100: 55% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned
4:52.821 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 49.3/100: 49% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned
4:54.004 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 43.6/100: 44% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned
4:55.767 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 18.1/100: 18% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned
4:56.933 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 19.3/100: 19% insanity twist_of_fate, shadowform, chorus_of_insanity(17), whispers_of_the_damned

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 8838 8035 7034
Intellect 1467 -3 8067 6916 5123 (377)
Spirit 0 0 0 0 0
Health 176760 160700 0
Mana 19999 19999 0
Insanity 100 100 0
Spell Power 8067 6916 0
Crit 20.12% 20.12% 1089
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 640 640 0
Mastery 21.97% 21.97% 742
Armor 1142 1142 1142
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 385, stats: { 148 Armor, +625 Int, +1127 Sta }
azerite powers: { Death Throes, Heed My Call, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 385, stats: { 137 Armor, +469 Int, +845 Sta }
azerite powers: { Whispers of the Damned, Earthlink, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 385, stats: { 183 Armor, +625 Int, +1127 Sta }
azerite powers: { Chorus of Insanity, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Twitching Tentacle of Xalzaix
ilevel: 385, stats: { +176 Crit }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: torrent_of_elements
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Fortress of the Mind (Shadow Priest) Shadowy Insight (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Body and Soul San'layn (Shadow Priest) Mania (Shadow Priest)
45 Twist of Fate (Shadow Priest) Misery (Shadow Priest) Dark Void (Shadow Priest)
60 Last Word (Shadow Priest) Mind Bomb (Shadow Priest) Psychic Horror (Shadow Priest)
75 Auspicious Spirits (Shadow Priest) Shadow Word: Death (Shadow Priest) Shadow Crash (Shadow Priest)
90 Lingering Insanity (Shadow Priest) Mindbender (Shadow Priest) Void Torrent (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Dark Ascension (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="T22_Priest_Shadow"
spec=shadow
level=120
race=troll
role=spell
position=ranged_back
talents=3111322

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast
actions.precombat+=/shadow_word_void

# Executed every time the actor is available.
actions=potion,if=buff.bloodlust.react|target.time_to_die<=80|target.health.pct<35
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/berserking
actions+=/run_action_list,name=aoe,if=spell_targets.mind_sear>(5+1*talent.misery.enabled)
actions+=/run_action_list,name=cleave,if=active_enemies>1
actions+=/run_action_list,name=single,if=active_enemies=1

actions.aoe=void_eruption
actions.aoe+=/dark_ascension,if=buff.voidform.down
actions.aoe+=/void_bolt,if=talent.dark_void.enabled&dot.shadow_word_pain.remains>travel_time
actions.aoe+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)
actions.aoe+=/dark_void,if=raid_event.adds.in>10
actions.aoe+=/mindbender
actions.aoe+=/shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
actions.aoe+=/mind_sear,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.aoe+=/shadow_word_pain

actions.cleave=void_eruption
actions.cleave+=/dark_ascension,if=buff.voidform.down
actions.cleave+=/void_bolt
actions.cleave+=/shadow_word_death,target_if=target.time_to_die<3|buff.voidform.down
actions.cleave+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)
actions.cleave+=/dark_void,if=raid_event.adds.in>10
actions.cleave+=/mindbender
actions.cleave+=/mind_blast
actions.cleave+=/shadow_crash,if=(raid_event.adds.in>5&raid_event.adds.duration<2)|raid_event.adds.duration>2
actions.cleave+=/shadow_word_pain,target_if=refreshable&target.time_to_die>4,if=!talent.misery.enabled&!talent.dark_void.enabled
actions.cleave+=/vampiric_touch,target_if=refreshable,if=(target.time_to_die>6)
actions.cleave+=/vampiric_touch,target_if=dot.shadow_word_pain.refreshable,if=(talent.misery.enabled&target.time_to_die>4)
actions.cleave+=/void_torrent
actions.cleave+=/mind_sear,target_if=spell_targets.mind_sear>2,chain=1,interrupt=1
actions.cleave+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.cleave+=/shadow_word_pain

actions.single=void_eruption
actions.single+=/dark_ascension,if=buff.voidform.down
actions.single+=/void_bolt
actions.single+=/shadow_word_death,if=target.time_to_die<3|cooldown.shadow_word_death.charges=2|(cooldown.shadow_word_death.charges=1&cooldown.shadow_word_death.remains<gcd.max)
actions.single+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)&target.time_to_die>200|target.time_to_die<75
actions.single+=/dark_void,if=raid_event.adds.in>10
actions.single+=/mindbender
actions.single+=/shadow_word_death,if=!buff.voidform.up|(cooldown.shadow_word_death.charges=2&buff.voidform.stack<15)
actions.single+=/shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
actions.single+=/mind_blast,if=variable.dots_up
actions.single+=/void_torrent,if=dot.shadow_word_pain.remains>4&dot.vampiric_touch.remains>4
actions.single+=/shadow_word_pain,if=refreshable&target.time_to_die>4&!talent.misery.enabled&!talent.dark_void.enabled
actions.single+=/vampiric_touch,if=refreshable&target.time_to_die>6|(talent.misery.enabled&dot.shadow_word_pain.refreshable)
actions.single+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.single+=/shadow_word_pain

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507,azerite_powers=404/22/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507,azerite_powers=236/461/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507,azerite_powers=405/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=twitching_tentacle_of_xalzaix,id=160656,bonus_id=4800/1507
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=torrent_of_elements
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7034
# gear_intellect=5123
# gear_crit_rating=1089
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1142

T22_Rogue_Assassination : 16706 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16706.1 16706.1 9.3 / 0.056% 1606.3 / 9.6% 675.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
24.7 24.3 Energy 38.20% 36.8 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Subterfuge
  • 45: Vigor
  • 90: Toxic Blade (Assassination Rogue)
  • 100: Poison Bomb (Assassination Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Assassination 16706
auto_attack_mh 2093 12.5% 256.3 1.17sec 2447 2109 Direct 256.3 2327 4652 2447 24.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 256.28 256.28 0.00 0.00 1.1603 0.0000 627217.46 896682.69 30.05 2109.33 2109.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.63 56.82% 2326.72 1916 3315 2327.93 2231 2439 338842 484415 30.05
crit 61.99 24.19% 4652.00 3832 6629 4654.28 4340 5064 288375 412267 30.05
miss 48.66 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 1038 6.2% 254.3 1.18sec 1223 1046 Direct 254.3 1163 2324 1223 24.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 254.34 254.34 0.00 0.00 1.1691 0.0000 311128.86 444796.07 30.05 1046.35 1046.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.57 56.84% 1162.57 958 1657 1163.16 1119 1218 168078 240288 30.05
crit 61.55 24.20% 2324.16 1916 3315 2325.38 2163 2520 143050 204508 30.05
miss 48.22 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Deadly Poison (_dot) 1088 6.5% 542.1 0.71sec 601 0 Periodic 197.7 1328 2655 1648 24.1% 0.0% 99.6%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 542.14 0.00 197.74 197.74 0.0000 1.5104 325970.76 325970.76 0.00 1091.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 150.0 75.85% 1327.99 980 2297 1328.77 1272 1385 199183 199183 0.00
crit 47.8 24.15% 2655.13 1960 4594 2656.66 2366 3005 126788 126788 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*{$2818d=12 seconds}/$2818t1} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.063000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 2181 13.1% 541.1 0.71sec 1207 0 Direct 541.1 972 1943 1207 24.2% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 541.14 541.14 0.00 0.00 0.0000 0.0000 653264.26 653264.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 410.05 75.78% 971.85 700 1641 972.41 931 1032 398509 398509 0.00
crit 131.09 24.22% 1943.33 1400 3281 1944.56 1814 2089 254755 254755 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 2607 15.6% 39.0 7.60sec 19990 19901 Direct 39.0 16102 32184 19990 24.2% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.05 39.05 0.00 0.00 1.0045 0.0000 780559.54 780559.54 0.00 19901.06 19901.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.61 75.82% 16101.89 9989 29169 16112.83 14453 17758 476722 476722 0.00
crit 9.44 24.18% 32184.23 19978 58338 32200.51 20988 49091 303837 303837 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow 287 1.7% 3.6 73.03sec 24088 0 Direct 3.6 19413 38825 24088 24.1% 0.0%  

Stats details: frenetic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 3.58 0.00 0.00 0.0000 0.0000 86134.78 123140.01 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.71 75.92% 19412.98 19365 19900 19020.03 0 19900 52699 75340 29.44
crit 0.86 24.08% 38825.36 38730 39799 23464.68 0 39799 33436 47800 18.16
 
 

Action details: frenetic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=12846} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:25774.82
  • base_dd_max:25774.82
 
Garrote 2388 14.3% 16.9 18.10sec 42249 42061 Periodic 198.1 2904 5813 3611 24.3% 0.0% 99.2%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.93 0.00 198.11 198.11 1.0045 1.5024 715421.36 715421.36 0.00 2273.73 42061.34
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 150.0 75.69% 2904.37 1 6731 2907.21 2664 3151 435516 435516 0.00
crit 48.2 24.31% 5812.63 5 13463 5817.87 4729 7185 279905 279905 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.120000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mutilate 0 (2179) 0.0% (13.0%) 94.0 3.19sec 6938 6907

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.04 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 6907.33 6907.33
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.use_filler
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of $<dmg> Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Mutilate (_mh) 1453 8.7% 94.0 3.19sec 4627 0 Direct 94.0 3720 7441 4627 24.4% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.04 94.04 0.00 0.00 0.0000 0.0000 435116.58 622051.40 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.12 75.63% 3720.36 3021 5161 3722.51 3559 3892 264591 378264 30.05
crit 22.92 24.37% 7441.44 6043 10322 7445.58 6666 8365 170526 243787 30.05
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Mutilate (_oh) 726 4.3% 94.0 3.19sec 2311 0 Direct 94.0 1860 3721 2311 24.2% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.04 94.04 0.00 0.00 0.0000 0.0000 217335.85 310707.70 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.24 75.76% 1860.07 1511 2580 1861.13 1777 1952 132518 189450 30.05
crit 22.79 24.24% 3721.39 3021 5161 3722.88 3309 4178 84818 121258 30.05
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Poison Bomb 403 2.4% 39.4 6.49sec 3062 0 Direct 39.4 2466 4930 3062 24.2% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.44 39.44 0.00 0.00 0.0000 0.0000 120761.46 120761.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.89 75.79% 2465.55 1882 4011 2467.34 1961 3361 73694 73694 0.00
crit 9.55 24.21% 4930.06 3764 8021 4927.98 0 7474 47068 47068 0.00
 
 

Action details: poison_bomb

Static Values
  • id:255546
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:255546
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc255544=Envenom and Rupture have a $<chance>% chance per combo point spent to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$255546s1=0}*{$s2=4}} Nature damage over {$255545d=2 seconds} to all enemies within it.}
 
Rupture 1930 11.6% 13.3 22.51sec 43518 43324 Periodic 196.3 2371 4743 2946 24.2% 0.0% 98.8%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.29 0.00 196.33 196.33 1.0045 1.5091 578337.73 578337.73 0.00 1867.89 43324.42
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.8 75.78% 2371.25 1 3514 2372.53 2293 2471 352768 352768 0.00
crit 47.6 24.22% 4742.83 8 7029 4745.56 4348 5217 225570 225570 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${$o1*2} over 8 sec 2 points: ${$o1*3} over 12 sec 3 points: ${$o1*4} over 16 sec 4 points: ${$o1*5} over 20 sec 5 points: ${$o1*6} over 24 sec{$?s193531=false}[ 6 points: ${$o1*7} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.125300
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Toxic Blade 512 3.1% 12.2 25.17sec 12579 12523 Direct 12.2 10115 20230 12579 24.4% 0.0%  

Stats details: toxic_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.21 12.21 0.00 0.00 1.0045 0.0000 153548.63 153548.63 0.00 12523.34 12523.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.23 75.64% 10114.89 8272 14865 10119.49 8746 11532 93388 93388 0.00
crit 2.97 24.36% 20230.18 16545 29730 19467.09 0 28931 60161 60161 0.00
 
 

Action details: toxic_blade

Static Values
  • id:245388
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:25.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticking
Spelldata
  • id:245388
  • name:Toxic Blade
  • school:nature
  • tooltip:
  • description:Stab your enemy with a toxic poisoned blade, dealing {$s2=0} Nature damage. Your Nature damage done against the target is increased by {$245389s1=30}% for {$245389d=9 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Assassination
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
Berserking 2.0 240.20sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.8 127.82sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.0 120.10sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.rupture.ticking
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${{$256495s1=100}*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:27.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=4}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 129.2sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 240.2sec 240.2sec 6.42% 6.52% 0.0(0.0) 1.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 39.3 13.1 7.7sec 5.7sec 65.56% 53.84% 13.1(13.1) 38.7

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • elaborate_planning_1:65.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Increases damage done by {$s1=10}% for {$d=4 seconds}.
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Elemental Whirl (_crit) 2.6 0.2 75.4sec 65.6sec 8.99% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_crit_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.7 0.2 74.0sec 64.8sec 9.05% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_haste_1:9.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 75.1sec 65.9sec 8.95% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 74.8sec 65.6sec 9.02% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Envenom 20.4 18.6 14.6sec 7.6sec 66.90% 68.24% 18.6(18.6) 19.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • envenom_1:66.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Frothing Rage 5.0 12.1 64.2sec 17.4sec 75.50% 0.00% 0.0(0.0) 0.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.48%
  • frothing_rage_2:25.12%
  • frothing_rage_3:22.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Gale-Force Striking 7.1 4.4 42.1sec 24.9sec 44.30% 0.00% 4.4(4.4) 6.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_galeforce_striking
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • galeforce_striking_1:44.30%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267612
  • name:Gale-Force Striking
  • tooltip:Increases attack speed by $s%.
  • description:{$@spelldesc255141=Permanently enchant a weapon to sometimes increase your attack speed by $267612s% for {$267612d=15 seconds} when using melee or ranged attacks and abilities.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.9 0.0 59.5sec 37.3sec 37.73% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.48%
  • overwhelming_power_2:1.48%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.50%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.51%
  • overwhelming_power_9:1.52%
  • overwhelming_power_10:1.52%
  • overwhelming_power_11:1.53%
  • overwhelming_power_12:1.53%
  • overwhelming_power_13:1.54%
  • overwhelming_power_14:1.54%
  • overwhelming_power_15:1.54%
  • overwhelming_power_16:1.55%
  • overwhelming_power_17:1.56%
  • overwhelming_power_18:1.56%
  • overwhelming_power_19:1.57%
  • overwhelming_power_20:1.57%
  • overwhelming_power_21:1.58%
  • overwhelming_power_22:1.58%
  • overwhelming_power_23:1.59%
  • overwhelming_power_24:1.62%
  • overwhelming_power_25:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.1sec 10.4sec 68.82% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.89%
  • quick_navigation_2:17.56%
  • quick_navigation_3:16.95%
  • quick_navigation_4:16.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.2sec 52.2sec 18.06% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 3.7 0.0 86.5sec 128.2sec 3.74% 3.83% 0.0(0.0) 3.7

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • subterfuge_1:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=100}% increased damage and have no cooldown when used from Stealth and for {$115192d=3 seconds} after breaking Stealth.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Titanic Overcharge 12.4 33.3 24.9sec 6.6sec 84.95% 0.00% 3.6(3.6) 11.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:38.83

Stack Uptimes

  • titanic_overcharge_1:23.02%
  • titanic_overcharge_2:16.79%
  • titanic_overcharge_3:12.27%
  • titanic_overcharge_4:8.99%
  • titanic_overcharge_5:6.52%
  • titanic_overcharge_6:4.76%
  • titanic_overcharge_7:3.44%
  • titanic_overcharge_8:9.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=34} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 24.8 28.3 12.3sec 5.7sec 66.57% 0.00% 2.3(2.3) 24.2

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:31.13%
  • unstable_flames_2:16.56%
  • unstable_flames_3:8.87%
  • unstable_flames_4:4.66%
  • unstable_flames_5:5.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 2.8 0.0 127.8sec 127.8sec 0.34% 0.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Vendetta (_energy) 3.0 0.0 120.1sec 120.1sec 2.99% 1.60% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vendetta_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vendetta_energy_1:2.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:256495
  • name:Vendetta
  • tooltip:Generating ${{$s1=100}*{$d=3 seconds}/5} Energy over {$d=3 seconds}.
  • description:{$@spelldesc79140=Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${{$256495s1=100}*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Seal Fate 48.7 6.9sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Assassination
envenom Energy 39.0 1366.7 35.0 35.0 571.1
envenom Combo Points 39.0 182.5 4.7 4.7 4276.2
garrote Energy 16.9 762.0 45.0 45.0 938.9
mutilate Energy 94.0 4701.8 50.0 50.0 138.8
rupture Energy 13.3 332.2 25.0 25.0 1740.7
rupture Combo Points 13.3 63.0 4.7 4.7 9184.1
toxic_blade Energy 12.2 244.1 20.0 20.0 629.0
Resource Gains Type Count Total Average Overflow
toxic_blade Combo Points 12.21 7.74 (3.12%) 0.63 4.46 36.57%
mutilate Combo Points 94.04 188.07 (75.67%) 2.00 0.00 0.00%
garrote Combo Points 16.93 16.93 (6.81%) 1.00 0.00 0.00%
energy_regen Energy 1965.69 4362.22 (59.83%) 2.22 4.67 0.11%
Seal Fate Combo Points 48.68 35.79 (14.40%) 0.74 12.89 26.47%
Vendetta Energy 30.99 168.48 (2.31%) 5.44 8.76 4.94%
Venomous Vim Energy 394.41 2760.75 (37.86%) 7.00 0.13 0.00%
Resource RPS-Gain RPS-Loss
Energy 24.30 24.69
Combo Points 0.83 0.82
Combat End Resource Mean Min Max
Energy 55.04 0.02 157.78
Combo Points 3.03 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Assassination Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Assassination Damage Per Second
Count 7499
Mean 16706.07
Minimum 15387.88
Maximum 18391.61
Spread ( max - min ) 3003.73
Range [ ( max - min ) / 2 * 100% ] 8.99%
Standard Deviation 411.4945
5th Percentile 16051.08
95th Percentile 17404.35
( 95th Percentile - 5th Percentile ) 1353.27
Mean Distribution
Standard Deviation 4.7518
95.00% Confidence Intervall ( 16696.76 - 16715.38 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2331
0.1 Scale Factor Error with Delta=300 1446
0.05 Scale Factor Error with Delta=300 5782
0.01 Scale Factor Error with Delta=300 144548
Priority Target DPS
Sample Data T22_Rogue_Assassination Priority Target Damage Per Second
Count 7499
Mean 16706.07
Minimum 15387.88
Maximum 18391.61
Spread ( max - min ) 3003.73
Range [ ( max - min ) / 2 * 100% ] 8.99%
Standard Deviation 411.4945
5th Percentile 16051.08
95th Percentile 17404.35
( 95th Percentile - 5th Percentile ) 1353.27
Mean Distribution
Standard Deviation 4.7518
95.00% Confidence Intervall ( 16696.76 - 16715.38 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2331
0.1 Scale Factor Error with Delta=300 1446
0.05 Scale Factor Error with Delta=300 5782
0.01 Scale Factor Error with Delta=300 144548
DPS(e)
Sample Data T22_Rogue_Assassination Damage Per Second (Effective)
Count 7499
Mean 16706.07
Minimum 15387.88
Maximum 18391.61
Spread ( max - min ) 3003.73
Range [ ( max - min ) / 2 * 100% ] 8.99%
Damage
Sample Data T22_Rogue_Assassination Damage
Count 7499
Mean 5004797.26
Minimum 3765422.77
Maximum 6201283.89
Spread ( max - min ) 2435861.13
Range [ ( max - min ) / 2 * 100% ] 24.34%
DTPS
Sample Data T22_Rogue_Assassination Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Assassination Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Assassination Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Assassination Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Assassination Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Assassination Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_AssassinationTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Assassination Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion
7 0.00 marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=energy_regen_combined,value=energy.regen+poisoned_bleeds*7%(2*spell_haste)
8 0.00 call_action_list,name=stealthed,if=stealthed.rogue
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=dot
B 0.00 call_action_list,name=direct
0.00 arcane_torrent,if=energy.deficit>=15+variable.energy_regen_combined
0.00 arcane_pulse
0.00 lights_judgment
actions.cds
# count action,conditions
C 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|debuff.vendetta.up&cooldown.vanish.remains<5
0.00 blood_fury,if=debuff.vendetta.up
D 1.96 berserking,if=debuff.vendetta.up
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit*1.5|(raid_event.adds.in>40&combo_points.deficit>=cp_max_spend)
E 2.97 vendetta,if=dot.rupture.ticking
0.00 vanish,if=talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
Vanish with Exsg + (Nightstalker, or Subterfuge only on 1T): Maximum CP and Exsg ready for next GCD
0.00 vanish,if=talent.nightstalker.enabled&!talent.exsanguinate.enabled&combo_points>=cp_max_spend&debuff.vendetta.up
Vanish with Nightstalker + No Exsg: Maximum CP and Vendetta up
F 2.75 vanish,if=talent.subterfuge.enabled&(!talent.exsanguinate.enabled|spell_targets.fan_of_knives>=2)&!stealthed.rogue&cooldown.garrote.up&dot.garrote.refreshable&(spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives|spell_targets.fan_of_knives>=4&combo_points.deficit>=4)
Vanish with Subterfuge + (No Exsg or 2T+): No stealth/subterfuge, Garrote Refreshable, enough space for incoming Garrote CP
0.00 vanish,if=talent.master_assassin.enabled&!stealthed.all&master_assassin_remains<=0&!dot.rupture.refreshable
Vanish with Master Assasin: No stealth and no active MA buff, Rupture not in refresh range
0.00 exsanguinate,if=dot.rupture.remains>4+4*cp_max_spend&!dot.garrote.refreshable
Exsanguinate when both Rupture and Garrote are up for long enough
G 12.21 toxic_blade,if=dot.rupture.ticking
actions.direct
# count action,conditions
H 38.82 envenom,if=combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
Envenom at 4+ (5+ with DS) CP. Immediately on 2+ targets, with Vendetta, or with TB; otherwise wait for some energy. Also wait if Exsg combo is coming up.
0.00 variable,name=use_filler,value=combo_points.deficit>1|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2
0.00 fan_of_knives,if=variable.use_filler&(buff.hidden_blades.stack>=19|spell_targets.fan_of_knives>=2+stealthed.rogue|buff.the_dreadlords_deceit.stack>=29)
0.00 blindside,if=variable.use_filler&(buff.blindside.up|!talent.venom_rush.enabled)
I 94.04 mutilate,if=variable.use_filler
actions.dot
# count action,conditions
0.00 rupture,if=talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
Special Rupture setup for Exsg
0.00 pool_resource,for_next=1
Garrote upkeep, also tries to use it as a special generator for the last CP before a finisher
J 13.23 garrote,cycle_targets=1,if=(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
0.00 crimson_tempest,if=spell_targets>=2&remains<2+(spell_targets>=5)&combo_points>=4
Crimson Tempest only on multiple targets at 4+ CP when running out in 2s (up to 4 targets) or 3s (5+ targets)
K 12.86 rupture,cycle_targets=1,if=combo_points>=4&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>4
Keep up Rupture at 4+ on all targets (when living long enough and not snapshot)
actions.stealthed
# count action,conditions
L 0.43 rupture,if=combo_points>=4&(talent.nightstalker.enabled|talent.subterfuge.enabled&talent.exsanguinate.enabled&spell_targets.fan_of_knives<2|!ticking)&target.time_to_die-remains>6
Nighstalker, or Subt+Exsg on 1T: Snapshot Rupture; Also use Rupture over Envenom if it's not applied (Opener)
M 0.23 envenom,if=combo_points>=cp_max_spend
N 3.70 garrote,cycle_targets=1,if=talent.subterfuge.enabled&refreshable&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>2
Subterfuge: Apply or Refresh with buffed Garrotes
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&remains<=10&pmultiplier<=1&!exsanguinated&target.time_to_die-remains>2
Subterfuge: Override normal Garrotes with snapshot versions
0.00 pool_resource,for_next=1
Subterfuge + Exsg: Even override a snapshot Garrote right after Rupture before Exsanguination
0.00 garrote,if=talent.subterfuge.enabled&talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&prev_gcd.1.rupture

Sample Sequence

012456NIIKEDGIHIIHIIHFNIHIIHIIKIIGHIIHJIIKIIHJIIGHIIHIIKJIIHIGIHIJIKIIHIIHGJIHIIKIIHEJIIHCIIGKIIHIFNHIIHIIKGIIHJIHIHIIHJIIGKIIHIIHJIHIIGKIIHJIHIHIIKJIGHIIHIEDIHIJIKIIHIGHIIHFNIIKIIGHIIJHIIHI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 apply_poison Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 potion Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, battle_potion_of_agility
0:00.000 stealthed N garrote Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.002 direct I mutilate Fluffy_Pillow 138.3/170: 81% energy | 1.0/5: 20% combo_points bloodlust, subterfuge, quick_navigation, elemental_whirl_crit, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.006 direct I mutilate Fluffy_Pillow 112.7/170: 66% energy | 3.0/5: 60% combo_points bloodlust, subterfuge, quick_navigation(2), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:03.009 dot K rupture Fluffy_Pillow 87.1/170: 51% energy | 5.0/5: 100% combo_points bloodlust, galeforce_striking, quick_navigation(2), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:04.014 cds E vendetta Fluffy_Pillow 79.6/170: 47% energy | 0.0/5: 0% combo_points bloodlust, elaborate_planning, galeforce_striking, quick_navigation(2), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:05.019 cds D berserking Fluffy_Pillow 131.2/170: 77% energy | 0.0/5: 0% combo_points bloodlust, vendetta_energy, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:05.019 cds G toxic_blade Fluffy_Pillow 131.2/170: 77% energy | 0.0/5: 0% combo_points bloodlust, berserking, vendetta_energy, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:06.024 direct I mutilate Fluffy_Pillow 165.5/170: 97% energy | 2.0/5: 40% combo_points bloodlust, berserking, vendetta_energy, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_crit, archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:07.029 direct H envenom Fluffy_Pillow 169.5/170: 100% energy | 4.0/5: 80% combo_points bloodlust, berserking, galeforce_striking, quick_navigation(3), elemental_whirl_crit, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:08.031 direct I mutilate Fluffy_Pillow 168.6/170: 99% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:09.035 direct I mutilate Fluffy_Pillow 152.8/170: 90% energy | 2.0/5: 40% combo_points bloodlust, berserking, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:10.038 direct H envenom Fluffy_Pillow 136.9/170: 81% energy | 5.0/5: 100% combo_points bloodlust, berserking, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(3), resounding_protection, battle_potion_of_agility
0:11.043 direct I mutilate Fluffy_Pillow 136.0/170: 80% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(3), resounding_protection, battle_potion_of_agility
0:12.048 direct I mutilate Fluffy_Pillow 106.1/170: 62% energy | 3.0/5: 60% combo_points bloodlust, berserking, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, archive_of_the_titans(3), resounding_protection, battle_potion_of_agility
0:13.053 direct H envenom Fluffy_Pillow 90.2/170: 53% energy | 5.0/5: 100% combo_points bloodlust, berserking, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, archive_of_the_titans(3), resounding_protection, battle_potion_of_agility
0:14.058 cds F vanish Fluffy_Pillow 89.3/170: 53% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, archive_of_the_titans(3), resounding_protection, battle_potion_of_agility
0:14.058 stealthed N garrote Fluffy_Pillow 89.3/170: 53% energy | 0.0/5: 0% combo_points bloodlust, berserking, vanish, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, archive_of_the_titans(3), resounding_protection, battle_potion_of_agility
0:15.063 direct I mutilate Fluffy_Pillow 78.3/170: 46% energy | 1.0/5: 20% combo_points bloodlust, envenom, subterfuge, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:16.068 direct H envenom Fluffy_Pillow 59.8/170: 35% energy | 4.0/5: 80% combo_points bloodlust, envenom, subterfuge, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:17.072 direct I mutilate Fluffy_Pillow 56.3/170: 33% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:18.077 Waiting     0.700 sec 37.9/170: 22% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:18.777 direct I mutilate Fluffy_Pillow 50.1/170: 29% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:19.782 Waiting     0.200 sec 31.8/170: 19% energy | 4.0/5: 80% combo_points bloodlust, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), archive_of_the_titans(4), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:19.982 direct H envenom Fluffy_Pillow 35.3/170: 21% energy | 4.0/5: 80% combo_points bloodlust, envenom, elaborate_planning, galeforce_striking, quick_navigation(3), archive_of_the_titans(4), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:20.986 Waiting     0.700 sec 31.9/170: 19% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:21.686 direct I mutilate Fluffy_Pillow 51.2/170: 30% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:22.693 Waiting     0.600 sec 25.9/170: 15% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:23.293 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(2)
0:24.298 dot K rupture Fluffy_Pillow 32.0/170: 19% energy | 4.0/5: 80% combo_points bloodlust, envenom, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(2)
0:25.303 Waiting     0.700 sec 24.7/170: 15% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), archive_of_the_titans(6), resounding_protection, titanic_overcharge(2)
0:26.003 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), archive_of_the_titans(6), resounding_protection, titanic_overcharge(2)
0:27.006 Waiting     0.900 sec 32.5/170: 19% energy | 3.0/5: 60% combo_points bloodlust, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge(2)
0:27.906 direct I mutilate Fluffy_Pillow 55.4/170: 33% energy | 3.0/5: 60% combo_points bloodlust, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge(2)
0:28.909 Waiting     0.900 sec 29.9/170: 18% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(6), resounding_protection
0:29.809 cds G toxic_blade Fluffy_Pillow 59.7/170: 35% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(6), resounding_protection
0:31.024 direct H envenom Fluffy_Pillow 75.0/170: 44% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:32.029 direct I mutilate Fluffy_Pillow 71.6/170: 42% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:33.033 direct I mutilate Fluffy_Pillow 53.3/170: 31% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:34.038 Waiting     0.227 sec 21.0/170: 12% energy | 4.0/5: 80% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), archive_of_the_titans(7), resounding_protection, titanic_overcharge(2)
0:34.265 direct H envenom Fluffy_Pillow 39.0/170: 23% energy | 4.0/5: 80% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(7), resounding_protection, titanic_overcharge(2)
0:36.035 dot J garrote Fluffy_Pillow 56.2/170: 33% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge(2)
0:37.039 Waiting     0.400 sec 36.0/170: 21% energy | 1.0/5: 20% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge(2)
0:37.439 direct I mutilate Fluffy_Pillow 50.0/170: 29% energy | 1.0/5: 20% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge(2)
0:38.444 Waiting     0.800 sec 25.6/170: 15% energy | 3.0/5: 60% combo_points bloodlust, envenom, frothing_rage(2), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge(2)
0:39.244 direct I mutilate Fluffy_Pillow 54.5/170: 32% energy | 3.0/5: 60% combo_points bloodlust, envenom, frothing_rage(2), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(8), resounding_protection, overwhelming_power(25), titanic_overcharge(2)
0:40.248 dot K rupture Fluffy_Pillow 31.4/170: 18% energy | 5.0/5: 100% combo_points bloodlust, envenom, frothing_rage(2), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(9), resounding_protection, overwhelming_power(24), titanic_overcharge(2)
0:41.252 Waiting     0.300 sec 39.1/170: 23% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(9), resounding_protection, overwhelming_power(23), titanic_overcharge(2)
0:41.552 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(9), resounding_protection, overwhelming_power(23), titanic_overcharge(2)
0:42.557 Waiting     0.943 sec 22.8/170: 13% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(9), resounding_protection, overwhelming_power(22), titanic_overcharge(2)
0:43.500 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(9), resounding_protection, overwhelming_power(21)
0:44.505 Waiting     4.331 sec 23.0/170: 14% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(9), resounding_protection, overwhelming_power(20)
0:48.836 direct H envenom Fluffy_Pillow 127.9/170: 75% energy | 5.0/5: 100% combo_points frothing_rage(3), archive_of_the_titans(10), resounding_protection, overwhelming_power(16)
0:49.841 dot J garrote Fluffy_Pillow 113.8/170: 67% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), archive_of_the_titans(10), resounding_protection, overwhelming_power(15), titanic_overcharge
0:50.845 direct I mutilate Fluffy_Pillow 89.6/170: 53% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage(3), archive_of_the_titans(11), resounding_protection, overwhelming_power(14), titanic_overcharge
0:51.851 direct I mutilate Fluffy_Pillow 60.4/170: 36% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), archive_of_the_titans(11), resounding_protection, overwhelming_power(13), titanic_overcharge
0:52.856 Waiting     2.000 sec 38.1/170: 22% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), archive_of_the_titans(11), resounding_protection, overwhelming_power(12), titanic_overcharge
0:54.856 cds G toxic_blade Fluffy_Pillow 79.4/170: 47% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation, unstable_flames, archive_of_the_titans(11), resounding_protection, overwhelming_power(10), titanic_overcharge
0:56.023 direct H envenom Fluffy_Pillow 89.4/170: 53% energy | 5.0/5: 100% combo_points frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(12), resounding_protection, overwhelming_power(8), titanic_overcharge
0:57.028 direct I mutilate Fluffy_Pillow 75.0/170: 44% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(12), resounding_protection, overwhelming_power(7), titanic_overcharge
0:58.032 Waiting     0.400 sec 45.6/170: 27% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(12), resounding_protection, overwhelming_power(6), titanic_overcharge
0:58.432 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(12), resounding_protection, overwhelming_power(6), titanic_overcharge
0:59.436 Waiting     0.500 sec 28.6/170: 17% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames(3), archive_of_the_titans(12), resounding_protection, overwhelming_power(5)
0:59.936 direct H envenom Fluffy_Pillow 35.3/170: 21% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames(3), archive_of_the_titans(12), resounding_protection, overwhelming_power(5)
1:00.940 Waiting     1.200 sec 27.8/170: 16% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames(4), archive_of_the_titans(13), resounding_protection, overwhelming_power(4)
1:02.140 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames(4), archive_of_the_titans(13), resounding_protection, overwhelming_power(2), titanic_overcharge
1:03.145 Waiting     1.164 sec 21.5/170: 13% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames(4), archive_of_the_titans(13), resounding_protection, overwhelming_power, titanic_overcharge
1:04.309 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 2.0/5: 40% combo_points envenom, frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames(4), archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:05.314 Waiting     0.365 sec 21.5/170: 13% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), galeforce_striking, quick_navigation(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge
1:05.679 dot K rupture Fluffy_Pillow 33.3/170: 20% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge
1:07.454 dot J garrote Fluffy_Pillow 46.0/170: 27% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge
1:08.459 Waiting     1.565 sec 21.5/170: 13% energy | 1.0/5: 20% combo_points elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge
1:10.024 direct I mutilate Fluffy_Pillow 56.4/170: 33% energy | 1.0/5: 20% combo_points frothing_rage(3), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(15), resounding_protection, titanic_overcharge
1:11.028 Waiting     1.200 sec 26.8/170: 16% energy | 3.0/5: 60% combo_points frothing_rage(3), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(15), resounding_protection, titanic_overcharge
1:12.228 direct I mutilate Fluffy_Pillow 56.8/170: 33% energy | 3.0/5: 60% combo_points frothing_rage(3), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(15), resounding_protection
1:13.233 Waiting     4.766 sec 20.1/170: 12% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(2), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(15), resounding_protection
1:17.999 direct H envenom Fluffy_Pillow 125.8/170: 74% energy | 5.0/5: 100% combo_points quick_navigation(2), unstable_flames, archive_of_the_titans(16), resounding_protection, titanic_overcharge
1:19.001 direct I mutilate Fluffy_Pillow 118.1/170: 69% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation(2), unstable_flames, archive_of_the_titans(16), resounding_protection, titanic_overcharge
1:20.007 cds G toxic_blade Fluffy_Pillow 88.6/170: 52% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, quick_navigation(2), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:21.024 direct I mutilate Fluffy_Pillow 89.2/170: 52% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:22.027 direct H envenom Fluffy_Pillow 59.7/170: 35% energy | 5.0/5: 100% combo_points envenom, quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:23.032 Waiting     0.100 sec 45.2/170: 27% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:23.132 direct I mutilate Fluffy_Pillow 53.5/170: 31% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:24.136 Waiting     0.500 sec 24.0/170: 14% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection
1:25.401 dot J garrote Fluffy_Pillow 54.9/170: 32% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, quick_navigation(3), archive_of_the_titans(18), resounding_protection
1:26.405 Waiting     1.000 sec 30.4/170: 18% energy | 3.0/5: 60% combo_points envenom, quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:27.405 direct I mutilate Fluffy_Pillow 50.8/170: 30% energy | 3.0/5: 60% combo_points envenom, quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:28.409 Waiting     0.276 sec 21.3/170: 13% energy | 5.0/5: 100% combo_points envenom, quick_navigation(3), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:28.685 dot K rupture Fluffy_Pillow 32.0/170: 19% energy | 5.0/5: 100% combo_points envenom, quick_navigation(3), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:29.689 Waiting     1.200 sec 27.5/170: 16% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation(3), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:30.889 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:31.894 Waiting     1.176 sec 21.2/170: 12% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage, quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:33.070 direct I mutilate Fluffy_Pillow 51.2/170: 30% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:34.074 Waiting     4.331 sec 21.9/170: 13% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(4), unstable_flames(3), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:38.405 direct H envenom Fluffy_Pillow 125.2/170: 74% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:39.408 direct I mutilate Fluffy_Pillow 111.4/170: 66% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:40.412 direct I mutilate Fluffy_Pillow 82.8/170: 49% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:41.419 Waiting     3.000 sec 61.1/170: 36% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:44.419 direct H envenom Fluffy_Pillow 125.0/170: 74% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:45.424 cds G toxic_blade Fluffy_Pillow 117.5/170: 69% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:46.429 dot J garrote Fluffy_Pillow 117.9/170: 69% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:47.433 direct I mutilate Fluffy_Pillow 93.4/170: 55% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:48.439 direct H envenom Fluffy_Pillow 63.9/170: 38% energy | 4.0/5: 80% combo_points envenom, frothing_rage, galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:49.445 direct I mutilate Fluffy_Pillow 56.4/170: 33% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:50.451 Waiting     1.300 sec 26.7/170: 16% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection
1:51.751 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection
1:52.758 dot K rupture Fluffy_Pillow 28.2/170: 17% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection
1:53.762 Waiting     1.517 sec 23.5/170: 14% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection
1:55.279 direct I mutilate Fluffy_Pillow 50.5/170: 30% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection
1:56.285 Waiting     1.200 sec 27.8/170: 16% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:57.485 direct I mutilate Fluffy_Pillow 50.7/170: 30% energy | 2.0/5: 40% combo_points frothing_rage(2), galeforce_striking, quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:58.489 Waiting     4.596 sec 21.1/170: 12% energy | 5.0/5: 100% combo_points frothing_rage(3), galeforce_striking, quick_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:03.085 direct H envenom Fluffy_Pillow 125.9/170: 74% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(3), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:04.089 cds E vendetta Fluffy_Pillow 118.9/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:05.092 dot J garrote Fluffy_Pillow 152.9/170: 90% energy | 0.0/5: 0% combo_points envenom, vendetta_energy, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:06.095 direct I mutilate Fluffy_Pillow 156.0/170: 92% energy | 1.0/5: 20% combo_points envenom, vendetta_energy, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:07.100 direct I mutilate Fluffy_Pillow 146.9/170: 86% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:08.104 direct H envenom Fluffy_Pillow 118.0/170: 69% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:09.108 cds C potion Fluffy_Pillow 112.1/170: 66% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(3)
2:09.108 direct I mutilate Fluffy_Pillow 112.1/170: 66% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(3), battle_potion_of_agility
2:10.111 direct I mutilate Fluffy_Pillow 84.1/170: 49% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(3), battle_potion_of_agility
2:11.116 cds G toxic_blade Fluffy_Pillow 55.8/170: 33% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(3), battle_potion_of_agility
2:12.121 dot K rupture Fluffy_Pillow 64.4/170: 38% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(3), battle_potion_of_agility
2:13.128 direct I mutilate Fluffy_Pillow 61.0/170: 36% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(3), battle_potion_of_agility
2:14.132 Waiting     0.600 sec 32.5/170: 19% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(3), battle_potion_of_agility
2:14.732 direct I mutilate Fluffy_Pillow 55.2/170: 32% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(3), battle_potion_of_agility
2:15.736 Waiting     0.546 sec 19.8/170: 12% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage(3), quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(3), battle_potion_of_agility
2:16.282 direct H envenom Fluffy_Pillow 42.0/170: 25% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(3), battle_potion_of_agility
2:17.286 Waiting     1.000 sec 29.0/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(3), battle_potion_of_agility
2:18.286 direct I mutilate Fluffy_Pillow 50.8/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge, battle_potion_of_agility
2:19.289 cds F vanish Fluffy_Pillow 29.6/170: 17% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(2), battle_potion_of_agility
2:20.309 stealthed N garrote Fluffy_Pillow 51.7/170: 30% energy | 3.0/5: 60% combo_points vanish, envenom, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(2), battle_potion_of_agility
2:21.314 Waiting     0.400 sec 28.6/170: 17% energy | 4.0/5: 80% combo_points subterfuge, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(3), battle_potion_of_agility
2:21.714 direct H envenom Fluffy_Pillow 41.5/170: 24% energy | 4.0/5: 80% combo_points subterfuge, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(3), battle_potion_of_agility
2:22.718 Waiting     1.000 sec 28.3/170: 17% energy | 0.0/5: 0% combo_points envenom, subterfuge, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(3), battle_potion_of_agility
2:23.718 direct I mutilate Fluffy_Pillow 57.0/170: 34% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(3), battle_potion_of_agility
2:24.723 Waiting     1.000 sec 28.7/170: 17% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(3), battle_potion_of_agility
2:25.723 direct I mutilate Fluffy_Pillow 50.1/170: 29% energy | 2.0/5: 40% combo_points envenom, frothing_rage(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(3), battle_potion_of_agility
2:26.727 Waiting     4.600 sec 27.8/170: 16% energy | 5.0/5: 100% combo_points frothing_rage(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(3), battle_potion_of_agility
2:31.327 direct H envenom Fluffy_Pillow 125.5/170: 74% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(4), battle_potion_of_agility
2:32.332 direct I mutilate Fluffy_Pillow 111.2/170: 65% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
2:33.335 direct I mutilate Fluffy_Pillow 89.6/170: 53% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(5), battle_potion_of_agility
2:34.338 Waiting     1.500 sec 61.2/170: 36% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(5)
2:35.838 dot K rupture Fluffy_Pillow 97.0/170: 57% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(6)
2:36.843 cds G toxic_blade Fluffy_Pillow 93.7/170: 55% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(6)
2:37.848 direct I mutilate Fluffy_Pillow 102.3/170: 60% energy | 1.0/5: 20% combo_points elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(6)
2:38.853 direct I mutilate Fluffy_Pillow 73.9/170: 43% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(7)
2:39.859 direct H envenom Fluffy_Pillow 45.6/170: 27% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(7)
2:41.375 dot J garrote Fluffy_Pillow 46.6/170: 27% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(7)
2:42.379 Waiting     1.000 sec 30.2/170: 18% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(7)
2:43.379 direct I mutilate Fluffy_Pillow 51.7/170: 30% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(7)
2:44.385 Waiting     0.524 sec 23.2/170: 14% energy | 4.0/5: 80% combo_points envenom, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(7)
2:44.909 direct H envenom Fluffy_Pillow 37.8/170: 22% energy | 4.0/5: 80% combo_points envenom, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(7)
2:45.915 Waiting     0.900 sec 24.2/170: 14% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(7)
2:46.815 direct I mutilate Fluffy_Pillow 51.1/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(7)
2:47.820 Waiting     4.662 sec 15.5/170: 9% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(7)
2:52.482 direct H envenom Fluffy_Pillow 132.6/170: 78% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(8)
2:53.487 direct I mutilate Fluffy_Pillow 119.4/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(8)
2:54.491 direct I mutilate Fluffy_Pillow 98.2/170: 58% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
2:55.496 Waiting     2.400 sec 70.0/170: 41% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
2:57.896 direct H envenom Fluffy_Pillow 126.2/170: 74% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:58.900 dot J garrote Fluffy_Pillow 119.8/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:59.905 direct I mutilate Fluffy_Pillow 89.5/170: 53% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:00.909 direct I mutilate Fluffy_Pillow 67.7/170: 40% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:01.913 cds G toxic_blade Fluffy_Pillow 45.7/170: 27% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:02.917 dot K rupture Fluffy_Pillow 39.8/170: 23% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:03.922 Waiting     0.600 sec 42.9/170: 25% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:04.522 direct I mutilate Fluffy_Pillow 58.3/170: 34% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:05.525 Waiting     1.000 sec 29.4/170: 17% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(2), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:06.525 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(2), galeforce_striking, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:07.530 Waiting     0.549 sec 21.5/170: 13% energy | 5.0/5: 100% combo_points frothing_rage(2), galeforce_striking, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:08.079 direct H envenom Fluffy_Pillow 36.2/170: 21% energy | 5.0/5: 100% combo_points frothing_rage(2), galeforce_striking, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:09.085 Waiting     0.992 sec 22.3/170: 13% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:10.077 direct I mutilate Fluffy_Pillow 50.1/170: 29% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:11.082 Waiting     1.404 sec 20.8/170: 12% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:12.486 direct I mutilate Fluffy_Pillow 54.0/170: 32% energy | 3.0/5: 60% combo_points envenom, frothing_rage(2), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:13.490 Waiting     4.300 sec 24.7/170: 15% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:17.790 direct H envenom Fluffy_Pillow 125.5/170: 74% energy | 5.0/5: 100% combo_points frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:18.796 dot J garrote Fluffy_Pillow 111.3/170: 65% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:19.802 direct I mutilate Fluffy_Pillow 86.7/170: 51% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:20.807 Waiting     3.000 sec 64.1/170: 38% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:23.807 direct H envenom Fluffy_Pillow 132.3/170: 78% energy | 4.0/5: 80% combo_points frothing_rage(3), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:24.811 direct I mutilate Fluffy_Pillow 110.9/170: 65% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:25.816 direct I mutilate Fluffy_Pillow 88.5/170: 52% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:26.819 cds G toxic_blade Fluffy_Pillow 52.1/170: 31% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(3), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:27.919 dot K rupture Fluffy_Pillow 61.1/170: 36% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:28.922 direct I mutilate Fluffy_Pillow 63.7/170: 37% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:29.929 Waiting     0.700 sec 27.5/170: 16% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:30.629 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:31.633 Waiting     0.753 sec 14.7/170: 9% energy | 5.0/5: 100% combo_points elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:32.386 direct H envenom Fluffy_Pillow 39.0/170: 23% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:34.411 dot J garrote Fluffy_Pillow 46.9/170: 28% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:35.417 Waiting     1.100 sec 30.3/170: 18% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:36.517 direct I mutilate Fluffy_Pillow 59.8/170: 35% energy | 1.0/5: 20% combo_points envenom, quick_navigation_final, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(20), resounding_protection
3:37.522 Waiting     4.200 sec 24.0/170: 14% energy | 4.0/5: 80% combo_points envenom, quick_navigation_final, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(20), resounding_protection
3:41.722 direct H envenom Fluffy_Pillow 125.2/170: 74% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation_final, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:42.726 direct I mutilate Fluffy_Pillow 111.1/170: 65% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:43.731 Waiting     2.300 sec 81.5/170: 48% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:46.031 direct H envenom Fluffy_Pillow 126.0/170: 74% energy | 4.0/5: 80% combo_points envenom, frothing_rage, galeforce_striking, quick_navigation, elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:47.037 direct I mutilate Fluffy_Pillow 118.4/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:48.043 direct I mutilate Fluffy_Pillow 95.8/170: 56% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:49.047 dot K rupture Fluffy_Pillow 59.2/170: 35% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:50.051 dot J garrote Fluffy_Pillow 61.7/170: 36% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:51.055 Waiting     0.500 sec 44.1/170: 26% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:51.555 direct I mutilate Fluffy_Pillow 50.8/170: 30% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:52.559 Waiting     0.795 sec 14.3/170: 8% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:53.354 cds G toxic_blade Fluffy_Pillow 39.0/170: 23% energy | 3.0/5: 60% combo_points frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:54.359 direct H envenom Fluffy_Pillow 46.6/170: 27% energy | 5.0/5: 100% combo_points frothing_rage(2), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:55.363 Waiting     0.900 sec 25.2/170: 15% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:56.263 direct I mutilate Fluffy_Pillow 51.3/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:57.266 Waiting     1.663 sec 14.8/170: 9% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection
3:58.929 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 2.0/5: 40% combo_points envenom, frothing_rage(2), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection
3:59.932 Waiting     0.500 sec 28.5/170: 17% energy | 4.0/5: 80% combo_points envenom, frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
4:00.432 direct H envenom Fluffy_Pillow 35.3/170: 21% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
4:01.435 Waiting     1.100 sec 27.7/170: 16% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:02.535 direct I mutilate Fluffy_Pillow 56.5/170: 33% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:03.539 Waiting     0.367 sec 20.1/170: 12% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:03.906 cds E vendetta Fluffy_Pillow 25.0/170: 15% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:05.092 cds D berserking Fluffy_Pillow 75.1/170: 44% energy | 2.0/5: 40% combo_points envenom, vendetta_energy, frothing_rage(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:05.092 direct I mutilate Fluffy_Pillow 75.1/170: 44% energy | 2.0/5: 40% combo_points berserking, envenom, vendetta_energy, frothing_rage(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:06.097 direct H envenom Fluffy_Pillow 74.8/170: 44% energy | 4.0/5: 80% combo_points berserking, vendetta_energy, frothing_rage(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:07.102 direct I mutilate Fluffy_Pillow 75.2/170: 44% energy | 0.0/5: 0% combo_points berserking, envenom, elaborate_planning, frothing_rage(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:08.109 dot J garrote Fluffy_Pillow 55.4/170: 33% energy | 2.0/5: 40% combo_points berserking, envenom, elaborate_planning, frothing_rage(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:09.113 Waiting     0.600 sec 40.8/170: 24% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:09.713 direct I mutilate Fluffy_Pillow 50.5/170: 30% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:10.718 dot K rupture Fluffy_Pillow 30.9/170: 18% energy | 5.0/5: 100% combo_points berserking, envenom, frothing_rage(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:11.722 Waiting     0.900 sec 36.2/170: 21% energy | 0.0/5: 0% combo_points berserking, elaborate_planning, frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:12.622 direct I mutilate Fluffy_Pillow 64.9/170: 38% energy | 0.0/5: 0% combo_points berserking, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:13.627 Waiting     0.400 sec 31.3/170: 18% energy | 2.0/5: 40% combo_points berserking, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:14.027 direct I mutilate Fluffy_Pillow 51.8/170: 30% energy | 2.0/5: 40% combo_points berserking, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:15.031 Waiting     0.426 sec 18.1/170: 11% energy | 4.0/5: 80% combo_points berserking, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection
4:15.457 direct H envenom Fluffy_Pillow 38.2/170: 22% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
4:16.460 Waiting     1.437 sec 17.4/170: 10% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:17.897 direct I mutilate Fluffy_Pillow 51.3/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:18.899 cds G toxic_blade Fluffy_Pillow 28.5/170: 17% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:19.906 Waiting     0.241 sec 21.8/170: 13% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:20.147 direct H envenom Fluffy_Pillow 39.0/170: 23% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:21.150 Waiting     1.479 sec 17.3/170: 10% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:22.629 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:23.633 Waiting     1.500 sec 28.3/170: 17% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:25.133 direct I mutilate Fluffy_Pillow 62.2/170: 37% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:26.136 Waiting     0.600 sec 25.5/170: 15% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation, archive_of_the_titans(20), resounding_protection
4:26.736 direct H envenom Fluffy_Pillow 47.4/170: 28% energy | 5.0/5: 100% combo_points quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:27.741 cds F vanish Fluffy_Pillow 25.8/170: 15% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:28.509 stealthed N garrote Fluffy_Pillow 50.0/170: 29% energy | 0.0/5: 0% combo_points vanish, envenom, elaborate_planning, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:29.515 Waiting     1.402 sec 18.3/170: 11% energy | 1.0/5: 20% combo_points envenom, subterfuge, elaborate_planning, frothing_rage, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:30.917 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 1.0/5: 20% combo_points envenom, subterfuge, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:31.919 Waiting     1.300 sec 28.7/170: 17% energy | 3.0/5: 60% combo_points envenom, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(25), titanic_overcharge(4)
4:33.219 direct I mutilate Fluffy_Pillow 54.5/170: 32% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(4)
4:34.223 dot K rupture Fluffy_Pillow 25.9/170: 15% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(4)
4:35.229 Waiting     1.100 sec 29.3/170: 17% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(4)
4:36.329 direct I mutilate Fluffy_Pillow 52.1/170: 31% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(4)
4:37.333 Waiting     0.913 sec 23.4/170: 14% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(4)
4:38.246 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(4)
4:39.250 Waiting     4.421 sec 14.7/170: 9% energy | 4.0/5: 80% combo_points frothing_rage, galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(4)
4:43.671 cds G toxic_blade Fluffy_Pillow 119.6/170: 70% energy | 4.0/5: 80% combo_points frothing_rage, galeforce_striking, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(5)
4:44.903 direct H envenom Fluffy_Pillow 131.1/170: 77% energy | 5.0/5: 100% combo_points frothing_rage, galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(6)
4:45.909 direct I mutilate Fluffy_Pillow 124.4/170: 73% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(6)
4:46.914 direct I mutilate Fluffy_Pillow 88.8/170: 52% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(8)
4:47.919 dot J garrote Fluffy_Pillow 67.1/170: 39% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(8)
4:48.924 direct H envenom Fluffy_Pillow 50.4/170: 30% energy | 5.0/5: 100% combo_points envenom, frothing_rage, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(8)
4:49.929 Waiting     0.500 sec 29.6/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(8)
4:50.429 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(8)
4:51.435 Waiting     1.527 sec 14.8/170: 9% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(8)
4:52.962 direct I mutilate Fluffy_Pillow 50.2/170: 30% energy | 2.0/5: 40% combo_points envenom, frothing_rage, galeforce_striking, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
4:53.967 Waiting     4.200 sec 28.2/170: 17% energy | 5.0/5: 100% combo_points envenom, frothing_rage, quick_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
4:58.167 direct H envenom Fluffy_Pillow 128.6/170: 76% energy | 5.0/5: 100% combo_points frothing_rage(2), galeforce_striking, quick_navigation(3), elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:59.170 direct I mutilate Fluffy_Pillow 107.9/170: 63% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), galeforce_striking, quick_navigation(3), elemental_whirl_crit, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 6566 6148 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 1676 1464 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Energy 170 170 0
Combo Points 5 5 0
Crit 22.58% 22.58% 906
Haste 19.37% 19.37% 1317
Damage / Heal Versatility 2.29% 2.29% 195
Attack Power 7223 6148 0
Mastery 27.39% 27.39% 584
Armor 1897 1897 1897
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Replicated Chitin Cord
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Quarantine Protocol Treads
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +104 Haste, +80 Vers }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: galeforce_striking
Local Off Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: quick_navigation

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Blindside (Assassination Rogue)
30 Nightstalker Subterfuge Master Assassin (Assassination Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Leeching Poison (Assassination Rogue) Cheat Death Elusiveness
75 Internal Bleeding (Assassination Rogue) Iron Wire (Assassination Rogue) Prey on the Weak
90 Venom Rush (Assassination Rogue) Toxic Blade (Assassination Rogue) Exsanguinate (Assassination Rogue)
100 Poison Bomb (Assassination Rogue) Hidden Blades (Assassination Rogue) Crimson Tempest (Assassination Rogue)

Profile

rogue="T22_Rogue_Assassination"
spec=assassination
level=120
race=troll
role=attack
position=back
talents=2210021

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion
actions.precombat+=/marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=variable,name=energy_regen_combined,value=energy.regen+poisoned_bleeds*7%(2*spell_haste)
actions+=/call_action_list,name=stealthed,if=stealthed.rogue
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=dot
actions+=/call_action_list,name=direct
actions+=/arcane_torrent,if=energy.deficit>=15+variable.energy_regen_combined
actions+=/arcane_pulse
actions+=/lights_judgment

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|debuff.vendetta.up&cooldown.vanish.remains<5
actions.cds+=/blood_fury,if=debuff.vendetta.up
actions.cds+=/berserking,if=debuff.vendetta.up
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit*1.5|(raid_event.adds.in>40&combo_points.deficit>=cp_max_spend)
actions.cds+=/vendetta,if=dot.rupture.ticking
# Vanish with Exsg + (Nightstalker, or Subterfuge only on 1T): Maximum CP and Exsg ready for next GCD
actions.cds+=/vanish,if=talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
# Vanish with Nightstalker + No Exsg: Maximum CP and Vendetta up
actions.cds+=/vanish,if=talent.nightstalker.enabled&!talent.exsanguinate.enabled&combo_points>=cp_max_spend&debuff.vendetta.up
# Vanish with Subterfuge + (No Exsg or 2T+): No stealth/subterfuge, Garrote Refreshable, enough space for incoming Garrote CP
actions.cds+=/vanish,if=talent.subterfuge.enabled&(!talent.exsanguinate.enabled|spell_targets.fan_of_knives>=2)&!stealthed.rogue&cooldown.garrote.up&dot.garrote.refreshable&(spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives|spell_targets.fan_of_knives>=4&combo_points.deficit>=4)
# Vanish with Master Assasin: No stealth and no active MA buff, Rupture not in refresh range
actions.cds+=/vanish,if=talent.master_assassin.enabled&!stealthed.all&master_assassin_remains<=0&!dot.rupture.refreshable
# Exsanguinate when both Rupture and Garrote are up for long enough
actions.cds+=/exsanguinate,if=dot.rupture.remains>4+4*cp_max_spend&!dot.garrote.refreshable
actions.cds+=/toxic_blade,if=dot.rupture.ticking

# Envenom at 4+ (5+ with DS) CP. Immediately on 2+ targets, with Vendetta, or with TB; otherwise wait for some energy. Also wait if Exsg combo is coming up.
actions.direct=envenom,if=combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
actions.direct+=/variable,name=use_filler,value=combo_points.deficit>1|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2
actions.direct+=/fan_of_knives,if=variable.use_filler&(buff.hidden_blades.stack>=19|spell_targets.fan_of_knives>=2+stealthed.rogue|buff.the_dreadlords_deceit.stack>=29)
actions.direct+=/blindside,if=variable.use_filler&(buff.blindside.up|!talent.venom_rush.enabled)
actions.direct+=/mutilate,if=variable.use_filler

# Special Rupture setup for Exsg
actions.dot=rupture,if=talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
# Garrote upkeep, also tries to use it as a special generator for the last CP before a finisher
actions.dot+=/pool_resource,for_next=1
actions.dot+=/garrote,cycle_targets=1,if=(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
# Crimson Tempest only on multiple targets at 4+ CP when running out in 2s (up to 4 targets) or 3s (5+ targets)
actions.dot+=/crimson_tempest,if=spell_targets>=2&remains<2+(spell_targets>=5)&combo_points>=4
# Keep up Rupture at 4+ on all targets (when living long enough and not snapshot)
actions.dot+=/rupture,cycle_targets=1,if=combo_points>=4&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>4

# Nighstalker, or Subt+Exsg on 1T: Snapshot Rupture; Also use Rupture over Envenom if it's not applied (Opener)
actions.stealthed=rupture,if=combo_points>=4&(talent.nightstalker.enabled|talent.subterfuge.enabled&talent.exsanguinate.enabled&spell_targets.fan_of_knives<2|!ticking)&target.time_to_die-remains>6
actions.stealthed+=/envenom,if=combo_points>=cp_max_spend
# Subterfuge: Apply or Refresh with buffed Garrotes
actions.stealthed+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&refreshable&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>2
# Subterfuge: Override normal Garrotes with snapshot versions
actions.stealthed+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&remains<=10&pmultiplier<=1&!exsanguinated&target.time_to_die-remains>2
# Subterfuge + Exsg: Even override a snapshot Garrote right after Rupture before Exsanguination
actions.stealthed+=/pool_resource,for_next=1
actions.stealthed+=/garrote,if=talent.subterfuge.enabled&talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&prev_gcd.1.rupture

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=replicated_chitin_cord,id=160717,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=quarantine_protocol_treads,id=160624,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=galeforce_striking
off_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=906
# gear_haste_rating=1317
# gear_mastery_rating=584
# gear_versatility_rating=195
# gear_armor=1897

T22_Rogue_Outlaw : 17268 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17268.4 17268.4 17.9 / 0.104% 3112.3 / 18.0% 512.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
33.7 33.3 Energy 8.69% 58.5 100.0% 100%
Talents
  • 15: Quick Draw (Outlaw Rogue)
  • 30: Hit and Run (Outlaw Rogue)
  • 45: Vigor
  • 90: Alacrity (Outlaw Rogue)
  • 100: Killing Spree (Outlaw Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Outlaw 17268
Ambush 245 1.4% 6.8 56.25sec 10872 10824 Direct 6.8 8502 17281 10872 27.0% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.75 6.75 0.00 0.00 1.0045 0.0000 73400.08 104934.23 30.05 10824.37 10824.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.93 73.00% 8501.62 7715 11136 8495.06 0 10773 41898 59898 30.04
crit 1.82 27.00% 17281.42 15739 22718 15112.79 0 22718 31503 45037 26.29
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing {$s1=0} Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
auto_attack_mh 2734 15.8% 246.8 1.22sec 3321 2773 Direct 246.8 2988 6094 3321 29.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 246.79 246.79 0.00 0.00 1.1978 0.0000 819667.87 1171813.66 30.05 2772.71 2772.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.22 51.96% 2988.34 2800 3387 2988.71 2950 3050 383172 547790 30.05
crit 71.63 29.02% 6093.65 5712 6909 6094.26 5999 6222 436496 624023 30.05
miss 46.94 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 1352 7.8% 243.9 1.23sec 1662 1367 Direct 243.9 1494 3047 1662 29.1% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 243.94 243.94 0.00 0.00 1.2156 0.0000 405349.14 579495.28 30.05 1366.90 1366.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.66 51.92% 1494.03 1400 1693 1494.21 1473 1525 189236 270536 30.05
crit 70.93 29.08% 3046.94 2856 3454 3047.24 2996 3128 216113 308959 30.05
miss 46.36 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Between the Eyes 746 4.3% 8.3 24.14sec 26878 28773 Direct 8.3 7518 31060 26878 82.2% 0.0%  

Stats details: between_the_eyes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.9342 0.0000 223794.44 319941.03 30.05 28772.75 28772.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.48 17.77% 7517.68 4610 8797 5616.86 0 8797 11121 15898 22.45
crit 6.85 82.23% 31060.44 18993 36243 30337.77 0 35281 212674 304043 29.31
 
 

Action details: between_the_eyes

Static Values
  • id:199804
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
Spelldata
  • id:199804
  • name:Between the Eyes
  • school:physical
  • tooltip:Stunned.
  • description:Finishing move that deals damage with your pistol and stuns the target.$?a235484[ Critical strikes with this ability deal four times normal damage.][] 1 point : ${$<damage>*1} damage, 1 sec 2 points: ${$<damage>*2} damage, 2 sec 3 points: ${$<damage>*3} damage, 3 sec 4 points: ${$<damage>*4} damage, 4 sec 5 points: ${$<damage>*5} damage, 5 sec{$?s193531=false}[ 6 points: ${$<damage>*6} damage, 6 sec][]
 
Dispatch 3748 21.7% 59.9 4.89sec 18742 20110 Direct 59.9 14428 29477 18742 28.7% 0.0%  

Stats details: dispatch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.95 59.95 0.00 0.00 0.9320 0.0000 1123503.63 1606183.36 30.05 20110.33 20110.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.76 71.34% 14428.18 8516 17011 14451.95 13427 15202 616989 882060 30.05
crit 17.18 28.66% 29477.15 18185 34702 29514.24 26438 31763 506515 724124 30.05
 
 

Action details: dispatch

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Dispatch
  • school:physical
  • tooltip:
  • description:Finishing move that dispatches the enemy, dealing damage per combo point: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow 345 2.0% 4.0 66.47sec 25856 0 Direct 4.0 19652 40088 25856 30.4% 0.0%  

Stats details: frenetic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 103542.95 148027.08 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.79 69.64% 19652.41 19606 20140 19294.41 0 20140 54811 78359 29.50
crit 1.22 30.36% 40087.65 39995 41086 29840.78 0 41086 48732 69668 22.37
 
 

Action details: frenetic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=12846} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:25774.82
  • base_dd_max:25774.82
 
Killing Spree 0 (628) 0.0% (3.6%) 5.6 49.95sec 33629 14995

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 33.49 0.00 2.2428 0.3331 0.00 0.00 0.00 14995.06 14995.06
 
 

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec.
  • description:Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Killing Spree (_mh) 314 1.8% 33.5 7.13sec 2813 0 Periodic 33.5 2146 4374 2813 29.9% 0.0% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.49 0.00 0.00 33.49 0.0000 0.0000 94215.45 134692.30 30.05 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.5 70.06% 2145.84 2023 2377 2145.83 2094 2227 50355 71989 30.05
crit 10.0 29.94% 4374.40 4127 4849 4373.15 0 4849 43860 62703 30.05
 
 

Action details: killing_spree_mh

Static Values
  • id:57841
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57841
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Killing Spree (_oh) 314 1.8% 33.5 7.13sec 2813 0 Periodic 33.5 2146 4375 2813 29.9% 0.0% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.49 0.00 0.00 33.49 0.0000 0.0000 94212.52 134688.11 30.05 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.5 70.07% 2145.79 2023 2377 2145.79 2095 2231 50358 71993 30.05
crit 10.0 29.93% 4374.63 4127 4849 4374.01 4201 4749 43854 62695 30.05
 
 

Action details: killing_spree_oh

Static Values
  • id:57842
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57842
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Main Gauche 2427 14.1% 136.0 2.32sec 5349 0 Direct 136.0 4089 8337 5349 29.7% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.05 136.05 0.00 0.00 0.0000 0.0000 727766.37 1040429.43 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.69 70.33% 4088.91 3769 5391 4089.35 3981 4330 391254 559345 30.05
crit 40.36 29.67% 8337.36 7688 10997 8338.41 8019 9044 336512 481085 30.05
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:{$@spelldesc76806=Your main-hand attacks have a {$h=30}% chance to trigger an attack with your off-hand that deals {$86392s1=0} Physical damage.}
 
Pistol Shot 1778 10.3% 52.5 5.64sec 10152 10916 Direct 52.5 7769 15795 10152 29.7% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.50 52.50 0.00 0.00 0.9301 0.0000 533031.54 762032.59 30.05 10915.84 10915.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.91 70.30% 7768.82 7073 10246 7772.80 7404 8778 286743 409934 30.05
crit 15.59 29.70% 15794.51 14429 20901 15806.13 14808 18139 246288 352099 30.05
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing ${{$s1=0}*$<CAP>/$AP} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Sinister Strike 3266 18.9% 187.0 2.22sec 5237 7843 Direct 187.0 3995 8122 5237 30.1% 0.0%  

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.01 187.01 0.00 0.00 0.6677 0.0000 979307.97 1400038.35 30.05 7843.19 7843.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.76 69.92% 3995.32 3646 5282 3997.55 3865 4476 522426 746870 30.05
crit 56.25 30.08% 8122.05 7438 10774 8129.24 7821 9232 456882 653168 30.05
 
 

Action details: sinister_strike

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193315
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:Viciously strike an enemy, causing ${{$s1=0}*$<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Outlaw
Adrenaline Rush 4.7 71.80sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.71 0.00 0.00 0.00 0.7910 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.8000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=60}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=60}% and your attack speed by {$s2=20}% for {$d=20 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 14.7 20.01sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.74 0.00 0.00 0.00 0.9287 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Vanish 5.8 56.25sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!stealthed.all&variable.ambush_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 4.7 0.0 71.1sec 71.6sec 30.19% 28.83% 0.0(0.0) 4.4

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • adrenaline_rush_1:30.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=60}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=60}% and your attack speed by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 78.9 0.0sec 3.7sec 99.05% 100.00% 74.9(74.9) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_alacrity
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • alacrity_1:0.94%
  • alacrity_2:0.95%
  • alacrity_3:0.97%
  • alacrity_4:0.96%
  • alacrity_5:95.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=2}% for {$d=20 seconds}.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:27.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=4}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 72.4sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Broadside 3.0 0.0 61.3sec 61.3sec 15.54% 13.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_broadside
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • broadside_1:15.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193356
  • name:Broadside
  • tooltip:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=20}% increased damage.
  • description:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=20}% increased damage for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 3.1 0.0 62.8sec 62.8sec 16.79% 15.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • buried_treasure_1:16.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by ${{$s1=20}/5} per sec.
  • description:Your base Energy regeneration is increased by ${{$s1=20}/5} per sec for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.7 0.2 74.5sec 65.3sec 9.05% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_crit_1:9.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.7 0.2 74.6sec 65.6sec 9.06% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_haste_1:9.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 74.5sec 65.8sec 9.03% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 75.4sec 66.1sec 8.92% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Frothing Rage 5.1 13.1 61.6sec 16.2sec 75.40% 0.00% 0.0(0.0) 0.4

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:26.78%
  • frothing_rage_2:25.24%
  • frothing_rage_3:23.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Gale-Force Striking 7.1 4.3 42.2sec 25.1sec 44.22% 0.00% 4.3(4.3) 6.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_galeforce_striking
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • galeforce_striking_1:44.22%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267612
  • name:Gale-Force Striking
  • tooltip:Increases attack speed by $s%.
  • description:{$@spelldesc255141=Permanently enchant a weapon to sometimes increase your attack speed by $267612s% for {$267612d=15 seconds} when using melee or ranged attacks and abilities.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Grand Melee 3.0 0.0 76.1sec 76.1sec 38.60% 39.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.65
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grand_melee_1:38.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=55}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=55}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Killing Spree 2.2 0.0 149.1sec 149.1sec 1.44% 0.00% 10.8(10.8) 2.1

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:2.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.40

Stack Uptimes

  • killing_spree_1:1.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51690
  • name:Killing Spree
  • tooltip:Attacking an enemy every $t1 sec.
  • description:Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.
  • max_stacks:0
  • duration:2.00
  • cooldown:120.00
  • default_chance:0.00%
Opportunity 52.8 0.0 5.6sec 5.6sec 33.18% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • opportunity_1:33.18%

Trigger Attempt Success

  • trigger_pct:39.58%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot costs {$s1=50}% less Energy and deals {$s3=100}% increased damage.
  • description:{$@spelldesc193315=Viciously strike an enemy, causing ${{$s1=0}*$<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 5.1 0.0 57.1sec 34.9sec 39.50% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.54%
  • overwhelming_power_2:1.55%
  • overwhelming_power_3:1.55%
  • overwhelming_power_4:1.56%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.58%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.60%
  • overwhelming_power_11:1.60%
  • overwhelming_power_12:1.60%
  • overwhelming_power_13:1.61%
  • overwhelming_power_14:1.61%
  • overwhelming_power_15:1.62%
  • overwhelming_power_16:1.63%
  • overwhelming_power_17:1.63%
  • overwhelming_power_18:1.64%
  • overwhelming_power_19:1.64%
  • overwhelming_power_20:1.65%
  • overwhelming_power_21:1.65%
  • overwhelming_power_22:1.66%
  • overwhelming_power_23:1.67%
  • overwhelming_power_24:1.70%
  • overwhelming_power_25:0.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.1sec 10.3sec 68.99% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.97%
  • quick_navigation_2:17.52%
  • quick_navigation_3:16.96%
  • quick_navigation_4:16.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.0sec 52.0sec 18.10% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roll the Bones 2.5 12.2 109.5sec 20.0sec 98.40% 0.00% 12.2(12.2) 1.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • roll_the_bones_1:98.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Ruthless Precision 3.0 0.0 75.6sec 75.6sec 38.83% 44.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_ruthless_precision
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • ruthless_precision_1:38.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193357
  • name:Ruthless Precision
  • tooltip:Critical strike chance of Between the Eyes increased by ${{$s1=20}+{$s2=40}}%. Critical strike chance of all other abilities increased by {$s1=20}%.
  • description:Increases the critical ctrike chance of Between the Eyes by ${{$s1=20}+{$s2=40}}% and the critical strike chance of all other abilities by {$s1=20}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Skull and Crossbones 3.1 0.0 62.7sec 62.7sec 16.57% 15.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_skull_and_crossbones
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • skull_and_crossbones_1:16.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199603
  • name:Skull and Crossbones
  • tooltip:Sinister Strike has an additional {$s1=30}% chance of striking an additional time.
  • description:Causes Sinister Strike to have an additional {$s1=30}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Titanic Overcharge 12.4 33.2 24.9sec 6.6sec 84.83% 0.00% 3.7(3.7) 11.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:38.83

Stack Uptimes

  • titanic_overcharge_1:23.06%
  • titanic_overcharge_2:16.84%
  • titanic_overcharge_3:12.20%
  • titanic_overcharge_4:8.88%
  • titanic_overcharge_5:6.46%
  • titanic_overcharge_6:4.70%
  • titanic_overcharge_7:3.44%
  • titanic_overcharge_8:9.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=34} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
True Bearing 3.1 0.0 62.9sec 62.9sec 16.98% 18.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • true_bearing_1:16.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishing moves reduce the remaining cooldown of many of your abilities by an additional $<cdr> sec per combo point.
  • description:Finishing moves reduce the remaining cooldown of many of your abilities by an additional $<cdr> sec per combo point.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unstable Flames 25.8 28.6 11.8sec 5.5sec 67.37% 0.00% 2.2(2.2) 25.2

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.00%
  • unstable_flames_2:16.85%
  • unstable_flames_3:8.82%
  • unstable_flames_4:4.62%
  • unstable_flames_5:5.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 5.8 0.0 56.0sec 56.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Roll the Bones: 1 buff 11.6 24.1sec
Roll the Bones: 2 buffs 2.9 76.3sec
Roll the Bones: 5 buffs 0.2 118.4sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Outlaw
ambush Energy 6.8 337.6 50.0 50.0 217.4
between_the_eyes Energy 8.3 208.2 25.0 25.0 1075.1
between_the_eyes Combo Points 8.3 40.3 4.8 4.8 5549.0
dispatch Energy 59.9 2098.1 35.0 35.0 535.5
dispatch Combo Points 59.9 287.7 4.8 4.8 3904.6
pistol_shot Energy 52.5 1050.0 20.0 20.0 507.6
roll_the_bones Energy 14.7 368.6 25.0 25.0 0.0
roll_the_bones Combo Points 14.7 71.2 4.8 4.8 0.0
sinister_strike Energy 187.0 6037.7 32.3 32.3 162.2
Resource Gains Type Count Total Average Overflow
pistol_shot Combo Points 52.50 52.50 (13.05%) 1.00 0.00 0.00%
sinister_strike Combo Points 187.01 174.46 (43.38%) 0.93 12.56 6.71%
ambush Combo Points 6.75 13.50 (3.36%) 2.00 0.00 0.00%
energy_regen Energy 1193.56 6141.18 (61.43%) 5.15 176.73 2.80%
Adrenaline Rush Energy 338.71 1069.35 (10.70%) 3.16 84.77 7.35%
Buried Treasure Energy 175.19 188.61 (1.89%) 1.08 12.74 6.33%
Combat Potency Energy 275.28 2598.15 (25.99%) 9.44 154.61 5.62%
Quick Draw Combo Points 52.50 52.50 (13.05%) 1.00 0.00 0.00%
Broadside Combo Points 31.79 29.33 (7.29%) 0.92 2.46 7.75%
Ruthlessness Combo Points 79.86 79.86 (19.86%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 33.32 33.67
Combo Points 1.34 1.33
Combat End Resource Mean Min Max
Energy 47.27 0.01 150.00
Combo Points 2.86 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.8%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Outlaw Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Outlaw Damage Per Second
Count 7499
Mean 17268.45
Minimum 14700.39
Maximum 20928.41
Spread ( max - min ) 6228.02
Range [ ( max - min ) / 2 * 100% ] 18.03%
Standard Deviation 792.6854
5th Percentile 16046.39
95th Percentile 18652.77
( 95th Percentile - 5th Percentile ) 2606.38
Mean Distribution
Standard Deviation 9.1538
95.00% Confidence Intervall ( 17250.51 - 17286.39 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8095
0.1 Scale Factor Error with Delta=300 5364
0.05 Scale Factor Error with Delta=300 21456
0.01 Scale Factor Error with Delta=300 536396
Priority Target DPS
Sample Data T22_Rogue_Outlaw Priority Target Damage Per Second
Count 7499
Mean 17268.45
Minimum 14700.39
Maximum 20928.41
Spread ( max - min ) 6228.02
Range [ ( max - min ) / 2 * 100% ] 18.03%
Standard Deviation 792.6854
5th Percentile 16046.39
95th Percentile 18652.77
( 95th Percentile - 5th Percentile ) 2606.38
Mean Distribution
Standard Deviation 9.1538
95.00% Confidence Intervall ( 17250.51 - 17286.39 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8095
0.1 Scale Factor Error with Delta=300 5364
0.05 Scale Factor Error with Delta=300 21456
0.01 Scale Factor Error with Delta=300 536396
DPS(e)
Sample Data T22_Rogue_Outlaw Damage Per Second (Effective)
Count 7499
Mean 17268.45
Minimum 14700.39
Maximum 20928.41
Spread ( max - min ) 6228.02
Range [ ( max - min ) / 2 * 100% ] 18.03%
Damage
Sample Data T22_Rogue_Outlaw Damage
Count 7499
Mean 5177791.97
Minimum 3749216.20
Maximum 7010955.30
Spread ( max - min ) 3261739.10
Range [ ( max - min ) / 2 * 100% ] 31.50%
DTPS
Sample Data T22_Rogue_Outlaw Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Outlaw Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Outlaw Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Outlaw Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Outlaw Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Outlaw Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_OutlawTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Outlaw Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion
6 0.00 marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
7 0.00 roll_the_bones,precombat_seconds=2
8 0.00 slice_and_dice,precombat_seconds=2
9 0.00 adrenaline_rush,precombat_seconds=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=rtb_buffs<2&(buff.loaded_dice.up|!buff.grand_melee.up&!buff.ruthless_precision.up)
Reroll for 2+ buffs with Loaded Dice up. Otherwise reroll for 2+ or Grand Melee or Ruthless Precision.
0.00 variable,name=ambush_condition,value=combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&cooldown.ghostly_strike.remains<1)+buff.broadside.up&energy>60&!buff.skull_and_crossbones.up
0.00 variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.up
With multiple targets, this variable is checked to decide whether some CDs should be synced with Blade Flurry
A 0.00 call_action_list,name=stealth,if=stealthed.all
B 0.00 call_action_list,name=cds
C 0.00 call_action_list,name=finish,if=combo_points>=cp_max_spend-(buff.broadside.up+buff.opportunity.up)*(talent.quick_draw.enabled&(!talent.marked_for_death.enabled|cooldown.marked_for_death.remains>1))
Finish at maximum CP. Substract one for each Broadside and Opportunity when Quick Draw is selected and MfD is not ready after the next second.
D 0.00 call_action_list,name=build
0.00 arcane_torrent,if=energy.deficit>=15+energy.regen
0.00 arcane_pulse
0.00 lights_judgment
actions.build
# count action,conditions
E 52.50 pistol_shot,if=combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
F 134.17 sinister_strike
actions.cds
# count action,conditions
G 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
H 3.71 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.time_to_max>1
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15-buff.adrenaline_rush.up*5)&!stealthed.rogue&combo_points.deficit>=cp_max_spend-1)
0.00 blade_flurry,if=spell_targets>=2&!buff.blade_flurry.up&(!raid_event.adds.exists|raid_event.adds.remains>8|cooldown.blade_flurry.charges=1&raid_event.adds.in>(2-cooldown.blade_flurry.charges_fractional)*25)
Blade Flurry on 2+ enemies. With adds: Use if they stay for 8+ seconds or if your next charge will be ready in time for the next wave.
0.00 ghostly_strike,if=variable.blade_flurry_sync&combo_points.deficit>=1+buff.broadside.up
I 5.60 killing_spree,if=variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
0.00 blade_rush,if=variable.blade_flurry_sync&energy.time_to_max>1
J 5.75 vanish,if=!stealthed.all&variable.ambush_condition
Using Vanish/Ambush is only a very tiny increase, so in reality, you're absolutely fine to use it as a utility spell.
0.00 shadowmeld,if=!stealthed.all&variable.ambush_condition
actions.finish
# count action,conditions
0.00 slice_and_dice,if=buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
K 14.74 roll_the_bones,if=(buff.roll_the_bones.remains<=3|variable.rtb_reroll)&(target.time_to_die>20|buff.roll_the_bones.remains<target.time_to_die)
L 8.33 between_the_eyes,if=buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
BTE with the Ruthless Precision buff from RtB or with the Ace Up Your Sleeve or Deadshot traits.
M 59.95 dispatch
actions.stealth
# count action,conditions
N 6.75 ambush

Sample Sequence

012459NJNFKFFKEFFKFEKFELFFFMEFMEFMEFFLEFMEFFMFFIMEFLEFMEFMEFMEFLEFKJNEMFEMFFMEFMHGEFMEFMEFFMEFMEIFFMEFMEFFKFFFMEFFMFFFFMFFFFMFEMFFMEFMEJNKFKEMFFMIFMEMFFMFMHEMFFMFFMFFMFFMFFMEMFFMFMEMFKEFFMFIFMEFMEFFMEFMEFFMFFMEFMEFFKFEKFFFFKFEHMJNFMEFFMFEMFEMFFFMEFFMFFMEFMEFIMEFFMEFMEFMEFKEKFMEMFMEMFMEMFMEMFMEMHFMEIFMEMFMEM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 5 potion Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, battle_potion_of_agility
Pre precombat 9 adrenaline_rush Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, adrenaline_rush, battle_potion_of_agility
0:00.000 stealth N ambush Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, adrenaline_rush, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.005 cds J vanish Fluffy_Pillow 138.5/150: 92% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, quick_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:01.005 stealth N ambush Fluffy_Pillow 138.5/150: 92% energy | 2.0/5: 40% combo_points bloodlust, vanish, adrenaline_rush, quick_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.010 build F sinister_strike Fluffy_Pillow 135.4/150: 90% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, quick_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.816 finish K roll_the_bones Fluffy_Pillow 130.1/150: 87% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, quick_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:03.622 build F sinister_strike Fluffy_Pillow 135.5/150: 90% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, roll_the_bones, alacrity, quick_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:04.426 build F sinister_strike Fluffy_Pillow 130.8/150: 87% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, roll_the_bones, alacrity, quick_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:05.231 finish K roll_the_bones Fluffy_Pillow 136.2/150: 91% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, opportunity, skull_and_crossbones, roll_the_bones, alacrity, quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:06.037 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, opportunity, true_bearing, roll_the_bones, alacrity(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:06.843 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, true_bearing, roll_the_bones, alacrity(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:07.648 build F sinister_strike Fluffy_Pillow 146.1/150: 97% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, true_bearing, roll_the_bones, alacrity(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(2), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:08.454 finish K roll_the_bones Fluffy_Pillow 142.2/150: 95% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, true_bearing, roll_the_bones, alacrity(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(2), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:09.258 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, buried_treasure, roll_the_bones, alacrity(3), galeforce_striking, quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(2), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:10.065 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, opportunity, buried_treasure, roll_the_bones, alacrity(3), galeforce_striking, quick_navigation, unstable_flames(4), archive_of_the_titans(3), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
0:10.867 finish K roll_the_bones Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, buried_treasure, roll_the_bones, alacrity(3), galeforce_striking, quick_navigation, unstable_flames(4), archive_of_the_titans(3), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
0:11.671 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(4), galeforce_striking, quick_navigation, unstable_flames(4), archive_of_the_titans(3), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
0:12.477 build E pistol_shot Fluffy_Pillow 137.5/150: 92% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(4), galeforce_striking, quick_navigation, archive_of_the_titans(3), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
0:13.280 finish L between_the_eyes Fluffy_Pillow 149.8/150: 100% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(4), frothing_rage, galeforce_striking, quick_navigation, archive_of_the_titans(3), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
0:14.084 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, archive_of_the_titans(3), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
0:14.890 build F sinister_strike Fluffy_Pillow 148.1/150: 99% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, archive_of_the_titans(3), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:15.696 build F sinister_strike Fluffy_Pillow 146.3/150: 98% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, archive_of_the_titans(4), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:16.503 finish M dispatch Fluffy_Pillow 134.6/150: 90% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, archive_of_the_titans(4), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:17.308 build E pistol_shot Fluffy_Pillow 142.8/150: 95% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, archive_of_the_titans(4), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:18.114 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, archive_of_the_titans(4), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:18.919 finish M dispatch Fluffy_Pillow 148.2/150: 99% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:19.722 build E pistol_shot Fluffy_Pillow 135.1/150: 90% energy | 1.0/5: 20% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:20.726 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:21.729 finish M dispatch Fluffy_Pillow 141.0/150: 94% energy | 5.0/5: 100% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:22.735 build E pistol_shot Fluffy_Pillow 132.1/150: 88% energy | 1.0/5: 20% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:23.742 build F sinister_strike Fluffy_Pillow 148.3/150: 99% energy | 3.0/5: 60% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge(5)
0:24.748 build F sinister_strike Fluffy_Pillow 129.5/150: 86% energy | 4.0/5: 80% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames(2), archive_of_the_titans(5), resounding_protection
0:25.753 finish L between_the_eyes Fluffy_Pillow 130.1/150: 87% energy | 5.0/5: 100% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames(2), archive_of_the_titans(6), resounding_protection
0:26.758 build E pistol_shot Fluffy_Pillow 130.7/150: 87% energy | 1.0/5: 20% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(6), resounding_protection
0:27.762 build F sinister_strike Fluffy_Pillow 146.3/150: 98% energy | 3.0/5: 60% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(6), resounding_protection, titanic_overcharge
0:28.767 finish M dispatch Fluffy_Pillow 127.0/150: 85% energy | 5.0/5: 100% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(6), resounding_protection, titanic_overcharge
0:29.771 build E pistol_shot Fluffy_Pillow 117.7/150: 78% energy | 1.0/5: 20% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(6), resounding_protection, titanic_overcharge
0:30.777 build F sinister_strike Fluffy_Pillow 133.5/150: 89% energy | 3.0/5: 60% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:31.780 build F sinister_strike Fluffy_Pillow 114.2/150: 76% energy | 4.0/5: 80% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:32.783 finish M dispatch Fluffy_Pillow 94.8/150: 63% energy | 5.0/5: 100% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:33.788 build F sinister_strike Fluffy_Pillow 85.6/150: 57% energy | 1.0/5: 20% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:34.793 build F sinister_strike Fluffy_Pillow 76.3/150: 51% energy | 2.0/5: 40% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:35.798 cds I killing_spree Fluffy_Pillow 57.0/150: 38% energy | 4.0/5: 80% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:38.087 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(8), resounding_protection
0:39.091 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), archive_of_the_titans(8), resounding_protection
0:40.095 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), archive_of_the_titans(9), resounding_protection
0:41.098 finish L between_the_eyes Fluffy_Pillow 140.1/150: 93% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), archive_of_the_titans(9), resounding_protection
0:42.103 build E pistol_shot Fluffy_Pillow 144.9/150: 97% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), archive_of_the_titans(9), resounding_protection
0:43.107 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), archive_of_the_titans(9), resounding_protection
0:44.111 finish M dispatch Fluffy_Pillow 134.8/150: 90% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), archive_of_the_titans(9), resounding_protection
0:45.116 build E pistol_shot Fluffy_Pillow 129.7/150: 86% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), archive_of_the_titans(10), resounding_protection, titanic_overcharge
0:46.119 build F sinister_strike Fluffy_Pillow 139.6/150: 93% energy | 3.0/5: 60% combo_points skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), archive_of_the_titans(10), resounding_protection, titanic_overcharge
0:47.122 finish M dispatch Fluffy_Pillow 114.4/150: 76% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge
0:48.125 build E pistol_shot Fluffy_Pillow 99.3/150: 66% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge
0:49.129 build F sinister_strike Fluffy_Pillow 109.2/150: 73% energy | 3.0/5: 60% combo_points skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge
0:50.133 finish M dispatch Fluffy_Pillow 84.1/150: 56% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:51.137 build E pistol_shot Fluffy_Pillow 79.0/150: 53% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:52.142 build F sinister_strike Fluffy_Pillow 88.9/150: 59% energy | 3.0/5: 60% combo_points skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(4), archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:53.145 finish L between_the_eyes Fluffy_Pillow 73.7/150: 49% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation(4), archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:54.150 build E pistol_shot Fluffy_Pillow 68.6/150: 46% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation(4), archive_of_the_titans(11), resounding_protection
0:55.155 build F sinister_strike Fluffy_Pillow 68.5/150: 46% energy | 3.0/5: 60% combo_points skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(12), resounding_protection
0:56.160 finish K roll_the_bones Fluffy_Pillow 63.3/150: 42% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(12), resounding_protection
0:57.165 cds J vanish Fluffy_Pillow 68.1/150: 45% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:57.165 stealth N ambush Fluffy_Pillow 68.1/150: 45% energy | 1.0/5: 20% combo_points vanish, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:58.171 build E pistol_shot Fluffy_Pillow 58.0/150: 39% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:59.176 finish M dispatch Fluffy_Pillow 67.9/150: 45% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(3), archive_of_the_titans(12), resounding_protection, titanic_overcharge
1:00.180 build F sinister_strike Fluffy_Pillow 52.8/150: 35% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(3), archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:01.182 build E pistol_shot Fluffy_Pillow 39.2/150: 26% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(13), resounding_protection, overwhelming_power(24), titanic_overcharge
1:02.187 finish M dispatch Fluffy_Pillow 40.5/150: 27% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(13), resounding_protection, overwhelming_power(23), titanic_overcharge
1:03.189 Waiting     0.400 sec 36.7/150: 24% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(13), resounding_protection, overwhelming_power(21), titanic_overcharge
1:03.589 build F sinister_strike Fluffy_Pillow 45.1/150: 30% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(13), resounding_protection, overwhelming_power(21), titanic_overcharge
1:04.592 Waiting     0.500 sec 31.2/150: 21% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(13), resounding_protection, overwhelming_power(20), titanic_overcharge
1:05.092 build F sinister_strike Fluffy_Pillow 51.7/150: 34% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power(19), titanic_overcharge(2)
1:06.099 finish M dispatch Fluffy_Pillow 37.9/150: 25% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power(18), titanic_overcharge(2)
1:07.104 build E pistol_shot Fluffy_Pillow 24.9/150: 17% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
1:08.108 build F sinister_strike Fluffy_Pillow 46.8/150: 31% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power(15), titanic_overcharge(3)
1:09.111 Waiting     0.100 sec 33.7/150: 22% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power(14), titanic_overcharge(3)
1:09.211 finish M dispatch Fluffy_Pillow 35.9/150: 24% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power(14), titanic_overcharge(3)
1:10.216 cds H adrenaline_rush Fluffy_Pillow 22.8/150: 15% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(15), resounding_protection, overwhelming_power(13), titanic_overcharge(3)
1:11.220 cds G potion Fluffy_Pillow 67.7/150: 45% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(15), resounding_protection, overwhelming_power(12), titanic_overcharge(3)
1:11.220 build E pistol_shot Fluffy_Pillow 67.7/150: 45% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(15), resounding_protection, overwhelming_power(12), titanic_overcharge(3), battle_potion_of_agility
1:12.025 build F sinister_strike Fluffy_Pillow 75.6/150: 50% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(15), resounding_protection, overwhelming_power(11), titanic_overcharge(3), battle_potion_of_agility
1:12.829 finish M dispatch Fluffy_Pillow 68.4/150: 46% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(15), resounding_protection, overwhelming_power(11), titanic_overcharge(3), battle_potion_of_agility
1:13.634 build E pistol_shot Fluffy_Pillow 81.2/150: 54% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(15), resounding_protection, overwhelming_power(10), titanic_overcharge(3), battle_potion_of_agility
1:14.439 build F sinister_strike Fluffy_Pillow 88.9/150: 59% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_versatility, archive_of_the_titans(15), resounding_protection, overwhelming_power(9), titanic_overcharge(3), battle_potion_of_agility
1:15.243 finish M dispatch Fluffy_Pillow 81.5/150: 54% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, archive_of_the_titans(16), resounding_protection, overwhelming_power(8), titanic_overcharge(3), battle_potion_of_agility
1:16.048 build E pistol_shot Fluffy_Pillow 84.1/150: 56% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, archive_of_the_titans(16), resounding_protection, overwhelming_power(7), titanic_overcharge(3), battle_potion_of_agility
1:16.852 build F sinister_strike Fluffy_Pillow 89.9/150: 60% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), archive_of_the_titans(16), resounding_protection, overwhelming_power(7), titanic_overcharge(3), battle_potion_of_agility
1:17.656 build F sinister_strike Fluffy_Pillow 70.5/150: 47% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), archive_of_the_titans(16), resounding_protection, overwhelming_power(6), titanic_overcharge(3), battle_potion_of_agility
1:18.458 finish M dispatch Fluffy_Pillow 50.7/150: 34% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), archive_of_the_titans(16), resounding_protection, overwhelming_power(5), battle_potion_of_agility
1:19.263 build E pistol_shot Fluffy_Pillow 50.8/150: 34% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames, archive_of_the_titans(16), resounding_protection, overwhelming_power(4), battle_potion_of_agility
1:20.068 build F sinister_strike Fluffy_Pillow 55.9/150: 37% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames, archive_of_the_titans(17), resounding_protection, overwhelming_power(3), battle_potion_of_agility
1:20.871 finish M dispatch Fluffy_Pillow 45.9/150: 31% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation, unstable_flames, archive_of_the_titans(17), resounding_protection, overwhelming_power(3), battle_potion_of_agility
1:21.675 build E pistol_shot Fluffy_Pillow 35.9/150: 24% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation, unstable_flames, archive_of_the_titans(17), resounding_protection, overwhelming_power(2), battle_potion_of_agility
1:22.478 Waiting     0.100 sec 40.9/150: 27% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation, unstable_flames, archive_of_the_titans(17), resounding_protection, overwhelming_power, battle_potion_of_agility
1:22.578 cds I killing_spree Fluffy_Pillow 44.0/150: 29% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation, unstable_flames, archive_of_the_titans(17), resounding_protection, overwhelming_power, battle_potion_of_agility
1:25.133 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:25.937 build F sinister_strike Fluffy_Pillow 140.3/150: 94% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:26.743 finish M dispatch Fluffy_Pillow 140.7/150: 94% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:27.547 build E pistol_shot Fluffy_Pillow 131.0/150: 87% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:28.350 build F sinister_strike Fluffy_Pillow 146.3/150: 98% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:29.153 finish M dispatch Fluffy_Pillow 136.6/150: 91% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:29.957 build E pistol_shot Fluffy_Pillow 127.0/150: 85% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:30.762 build F sinister_strike Fluffy_Pillow 135.9/150: 91% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:31.766 build F sinister_strike Fluffy_Pillow 110.7/150: 74% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:32.771 finish K roll_the_bones Fluffy_Pillow 105.6/150: 70% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:33.776 build F sinister_strike Fluffy_Pillow 110.5/150: 74% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), archive_of_the_titans(19), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:34.782 build F sinister_strike Fluffy_Pillow 105.3/150: 70% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), archive_of_the_titans(19), resounding_protection, battle_potion_of_agility
1:35.785 build F sinister_strike Fluffy_Pillow 80.1/150: 53% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, battle_potion_of_agility
1:36.789 finish M dispatch Fluffy_Pillow 84.9/150: 57% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
1:37.794 build E pistol_shot Fluffy_Pillow 79.7/150: 53% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
1:38.798 build F sinister_strike Fluffy_Pillow 89.5/150: 60% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
1:39.802 build F sinister_strike Fluffy_Pillow 74.4/150: 50% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:40.807 finish M dispatch Fluffy_Pillow 49.3/150: 33% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:41.811 Waiting     0.600 sec 34.2/150: 23% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:42.411 build F sinister_strike Fluffy_Pillow 46.1/150: 31% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:43.417 build F sinister_strike Fluffy_Pillow 51.0/150: 34% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:44.422 build F sinister_strike Fluffy_Pillow 45.9/150: 31% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:45.425 Waiting     0.800 sec 30.8/150: 21% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:46.225 build F sinister_strike Fluffy_Pillow 46.7/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:47.230 Waiting     0.200 sec 31.7/150: 21% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:47.430 finish M dispatch Fluffy_Pillow 35.7/150: 24% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:48.436 Waiting     0.300 sec 40.7/150: 27% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:48.736 build F sinister_strike Fluffy_Pillow 46.7/150: 31% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:49.739 Waiting     0.569 sec 21.6/150: 14% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:50.308 build F sinister_strike Fluffy_Pillow 53.0/150: 35% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:51.312 Waiting     0.800 sec 29.0/150: 19% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:52.112 build F sinister_strike Fluffy_Pillow 45.7/150: 30% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:53.117 Waiting     0.700 sec 31.7/150: 21% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:53.817 build F sinister_strike Fluffy_Pillow 56.4/150: 38% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:54.821 Waiting     0.200 sec 32.5/150: 22% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:55.021 finish M dispatch Fluffy_Pillow 36.7/150: 24% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:56.025 Waiting     0.200 sec 42.9/150: 29% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:56.225 build F sinister_strike Fluffy_Pillow 47.1/150: 31% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:57.229 build E pistol_shot Fluffy_Pillow 43.2/150: 29% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:58.234 finish M dispatch Fluffy_Pillow 54.4/150: 36% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:59.238 build F sinister_strike Fluffy_Pillow 50.5/150: 34% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:00.243 build F sinister_strike Fluffy_Pillow 46.7/150: 31% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:01.247 finish M dispatch Fluffy_Pillow 51.5/150: 34% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:02.252 build E pistol_shot Fluffy_Pillow 46.3/150: 31% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:03.256 build F sinister_strike Fluffy_Pillow 56.1/150: 37% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:04.259 finish M dispatch Fluffy_Pillow 51.0/150: 34% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:05.262 build E pistol_shot Fluffy_Pillow 45.8/150: 31% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:06.265 cds J vanish Fluffy_Pillow 65.7/150: 44% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:06.265 stealth N ambush Fluffy_Pillow 65.7/150: 44% energy | 3.0/5: 60% combo_points vanish, grand_melee, roll_the_bones, alacrity(5), frothing_rage, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:07.269 finish K roll_the_bones Fluffy_Pillow 55.6/150: 37% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:08.273 build F sinister_strike Fluffy_Pillow 60.4/150: 40% energy | 1.0/5: 20% combo_points broadside, roll_the_bones, alacrity(5), frothing_rage, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:09.278 finish K roll_the_bones Fluffy_Pillow 45.3/150: 30% energy | 5.0/5: 100% combo_points opportunity, broadside, roll_the_bones, alacrity(5), frothing_rage, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:10.283 build E pistol_shot Fluffy_Pillow 60.2/150: 40% energy | 1.0/5: 20% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:11.289 finish M dispatch Fluffy_Pillow 60.3/150: 40% energy | 4.0/5: 80% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:12.293 build F sinister_strike Fluffy_Pillow 45.3/150: 30% energy | 1.0/5: 20% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:13.298 Waiting     0.800 sec 30.4/150: 20% energy | 3.0/5: 60% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:14.098 build F sinister_strike Fluffy_Pillow 46.5/150: 31% energy | 3.0/5: 60% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:15.104 Waiting     0.665 sec 21.7/150: 14% energy | 5.0/5: 100% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:15.769 finish M dispatch Fluffy_Pillow 45.0/150: 30% energy | 5.0/5: 100% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:16.774 cds I killing_spree Fluffy_Pillow 41.7/150: 28% energy | 1.0/5: 20% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(8)
2:19.062 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(8)
2:20.067 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(8)
2:21.072 build E pistol_shot Fluffy_Pillow 147.0/150: 98% energy | 1.0/5: 20% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(8)
2:22.077 finish M dispatch Fluffy_Pillow 148.9/150: 99% energy | 4.0/5: 80% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(8)
2:23.081 build F sinister_strike Fluffy_Pillow 135.9/150: 91% energy | 1.0/5: 20% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(8)
2:24.083 build F sinister_strike Fluffy_Pillow 112.7/150: 75% energy | 3.0/5: 60% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(8)
2:25.088 finish M dispatch Fluffy_Pillow 89.6/150: 60% energy | 5.0/5: 100% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(8)
2:26.091 build F sinister_strike Fluffy_Pillow 76.4/150: 51% energy | 1.0/5: 20% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(8)
2:27.093 finish M dispatch Fluffy_Pillow 73.0/150: 49% energy | 5.0/5: 100% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(8)
2:28.097 cds H adrenaline_rush Fluffy_Pillow 69.7/150: 46% energy | 1.0/5: 20% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(8)
2:29.102 build E pistol_shot Fluffy_Pillow 113.6/150: 76% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(8)
2:29.906 finish M dispatch Fluffy_Pillow 120.5/150: 80% energy | 4.0/5: 80% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(8)
2:30.710 build F sinister_strike Fluffy_Pillow 112.3/150: 75% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(8)
2:31.514 build F sinister_strike Fluffy_Pillow 94.0/150: 63% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(8)
2:32.319 finish M dispatch Fluffy_Pillow 95.9/150: 64% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(8)
2:33.123 build F sinister_strike Fluffy_Pillow 97.6/150: 65% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(8)
2:33.928 build F sinister_strike Fluffy_Pillow 89.4/150: 60% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(8)
2:34.734 finish M dispatch Fluffy_Pillow 91.1/150: 61% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(8)
2:35.538 build F sinister_strike Fluffy_Pillow 82.7/150: 55% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(8)
2:36.340 build F sinister_strike Fluffy_Pillow 74.1/150: 49% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(8)
2:37.145 finish M dispatch Fluffy_Pillow 55.6/150: 37% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
2:37.950 build F sinister_strike Fluffy_Pillow 57.2/150: 38% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
2:38.755 build F sinister_strike Fluffy_Pillow 48.7/150: 32% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
2:39.562 finish M dispatch Fluffy_Pillow 40.2/150: 27% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(8)
2:40.367 Waiting     0.400 sec 32.4/150: 22% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:40.767 build F sinister_strike Fluffy_Pillow 55.9/150: 37% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:41.573 build F sinister_strike Fluffy_Pillow 48.0/150: 32% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:42.377 Waiting     0.200 sec 30.0/150: 20% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:42.577 finish M dispatch Fluffy_Pillow 36.8/150: 25% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:43.380 build E pistol_shot Fluffy_Pillow 38.8/150: 26% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_crit, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:44.185 finish M dispatch Fluffy_Pillow 55.9/150: 37% energy | 4.0/5: 80% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(4), elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:44.990 build F sinister_strike Fluffy_Pillow 58.5/150: 39% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:45.794 Waiting     0.100 sec 41.8/150: 28% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:45.894 build F sinister_strike Fluffy_Pillow 45.3/150: 30% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:46.699 finish M dispatch Fluffy_Pillow 38.7/150: 26% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:47.504 Waiting     0.400 sec 32.0/150: 21% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:47.904 build F sinister_strike Fluffy_Pillow 46.1/150: 31% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:48.709 finish M dispatch Fluffy_Pillow 41.3/150: 28% energy | 5.0/5: 100% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:49.713 build E pistol_shot Fluffy_Pillow 29.8/150: 20% energy | 1.0/5: 20% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(8)
2:50.716 finish M dispatch Fluffy_Pillow 42.7/150: 28% energy | 4.0/5: 80% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(8)
2:51.719 Waiting     0.700 sec 30.5/150: 20% energy | 1.0/5: 20% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(8)
2:52.419 build F sinister_strike Fluffy_Pillow 46.4/150: 31% energy | 1.0/5: 20% combo_points broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(8)
2:53.424 finish K roll_the_bones Fluffy_Pillow 44.2/150: 29% energy | 5.0/5: 100% combo_points opportunity, broadside, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(8)
2:54.430 build E pistol_shot Fluffy_Pillow 51.9/150: 35% energy | 1.0/5: 20% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(8)
2:55.434 build F sinister_strike Fluffy_Pillow 53.4/150: 36% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(8)
2:56.439 Waiting     0.300 sec 39.6/150: 26% energy | 4.0/5: 80% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(8)
2:56.739 build F sinister_strike Fluffy_Pillow 45.7/150: 30% energy | 4.0/5: 80% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17)
2:57.742 Waiting     0.591 sec 21.1/150: 14% energy | 5.0/5: 100% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
2:58.333 finish M dispatch Fluffy_Pillow 43.1/150: 29% energy | 5.0/5: 100% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(2)
2:59.338 Waiting     0.800 sec 28.5/150: 19% energy | 1.0/5: 20% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(2)
3:00.138 build F sinister_strike Fluffy_Pillow 54.9/150: 37% energy | 1.0/5: 20% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(2)
3:01.144 cds I killing_spree Fluffy_Pillow 40.3/150: 27% energy | 2.0/5: 40% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(2)
3:03.369 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 2.0/5: 40% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(3), galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(3)
3:04.373 finish M dispatch Fluffy_Pillow 135.4/150: 90% energy | 4.0/5: 80% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(3)
3:05.375 build E pistol_shot Fluffy_Pillow 130.7/150: 87% energy | 1.0/5: 20% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(4)
3:06.381 build F sinister_strike Fluffy_Pillow 141.1/150: 94% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(4)
3:07.384 finish M dispatch Fluffy_Pillow 126.5/150: 84% energy | 5.0/5: 100% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(4)
3:08.391 build E pistol_shot Fluffy_Pillow 121.9/150: 81% energy | 1.0/5: 20% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(4)
3:09.395 build F sinister_strike Fluffy_Pillow 132.2/150: 88% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(4)
3:10.397 build F sinister_strike Fluffy_Pillow 117.3/150: 78% energy | 4.0/5: 80% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(4)
3:11.400 finish M dispatch Fluffy_Pillow 102.5/150: 68% energy | 5.0/5: 100% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(4)
3:12.404 build E pistol_shot Fluffy_Pillow 107.5/150: 72% energy | 1.0/5: 20% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:13.407 build F sinister_strike Fluffy_Pillow 117.6/150: 78% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:14.411 finish M dispatch Fluffy_Pillow 92.6/150: 62% energy | 5.0/5: 100% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:15.415 build E pistol_shot Fluffy_Pillow 87.6/150: 58% energy | 1.0/5: 20% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation(4), archive_of_the_titans(20), resounding_protection
3:16.420 build F sinister_strike Fluffy_Pillow 87.4/150: 58% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
3:17.424 build F sinister_strike Fluffy_Pillow 82.5/150: 55% energy | 4.0/5: 80% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:18.430 finish M dispatch Fluffy_Pillow 58.4/150: 39% energy | 5.0/5: 100% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:19.433 build F sinister_strike Fluffy_Pillow 54.2/150: 36% energy | 1.0/5: 20% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:20.438 Waiting     0.300 sec 40.1/150: 27% energy | 2.0/5: 40% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:20.738 build F sinister_strike Fluffy_Pillow 46.4/150: 31% energy | 2.0/5: 40% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:21.743 finish M dispatch Fluffy_Pillow 52.4/150: 35% energy | 4.0/5: 80% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:22.748 build E pistol_shot Fluffy_Pillow 48.3/150: 32% energy | 1.0/5: 20% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:23.753 build F sinister_strike Fluffy_Pillow 59.3/150: 40% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:24.757 finish M dispatch Fluffy_Pillow 35.2/150: 23% energy | 5.0/5: 100% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:25.763 build E pistol_shot Fluffy_Pillow 21.2/150: 14% energy | 1.0/5: 20% combo_points opportunity, grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:26.766 Waiting     0.636 sec 22.2/150: 15% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:27.402 build F sinister_strike Fluffy_Pillow 45.2/150: 30% energy | 3.0/5: 60% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:28.406 Waiting     0.300 sec 29.7/150: 20% energy | 4.0/5: 80% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:28.706 build F sinister_strike Fluffy_Pillow 45.6/150: 30% energy | 4.0/5: 80% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:29.712 finish K roll_the_bones Fluffy_Pillow 30.3/150: 20% energy | 5.0/5: 100% combo_points grand_melee, skull_and_crossbones, roll_the_bones, alacrity(5), galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:30.717 Waiting     0.400 sec 29.0/150: 19% energy | 1.0/5: 20% combo_points buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:31.117 build F sinister_strike Fluffy_Pillow 48.4/150: 32% energy | 1.0/5: 20% combo_points buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:32.121 build E pistol_shot Fluffy_Pillow 27.3/150: 18% energy | 3.0/5: 60% combo_points opportunity, buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:33.125 finish K roll_the_bones Fluffy_Pillow 31.1/150: 21% energy | 5.0/5: 100% combo_points buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:34.128 Waiting     0.300 sec 40.0/150: 27% energy | 1.0/5: 20% combo_points buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:34.428 build F sinister_strike Fluffy_Pillow 47.2/150: 31% energy | 1.0/5: 20% combo_points buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:35.434 build F sinister_strike Fluffy_Pillow 46.3/150: 31% energy | 2.0/5: 40% combo_points buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:36.438 Waiting     0.400 sec 25.4/150: 17% energy | 3.0/5: 60% combo_points buried_treasure, roll_the_bones, alacrity(5), galeforce_striking, quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:36.838 build F sinister_strike Fluffy_Pillow 45.0/150: 30% energy | 3.0/5: 60% combo_points buried_treasure, roll_the_bones, alacrity(5), quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:37.841 Waiting     0.900 sec 24.1/150: 16% energy | 4.0/5: 80% combo_points buried_treasure, roll_the_bones, alacrity(5), quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:38.741 build F sinister_strike Fluffy_Pillow 55.8/150: 37% energy | 4.0/5: 80% combo_points buried_treasure, roll_the_bones, alacrity(5), quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:39.745 finish K roll_the_bones Fluffy_Pillow 35.0/150: 23% energy | 5.0/5: 100% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:40.748 Waiting     0.300 sec 40.2/150: 27% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:41.048 build F sinister_strike Fluffy_Pillow 46.3/150: 31% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:42.053 build E pistol_shot Fluffy_Pillow 33.0/150: 22% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(6)
3:43.057 cds H adrenaline_rush Fluffy_Pillow 44.7/150: 30% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(6)
3:44.101 finish M dispatch Fluffy_Pillow 100.2/150: 67% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(6)
3:44.906 cds J vanish Fluffy_Pillow 102.8/150: 69% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(6)
3:44.906 stealth N ambush Fluffy_Pillow 102.8/150: 69% energy | 1.0/5: 20% combo_points vanish, adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(6)
3:45.910 build F sinister_strike Fluffy_Pillow 96.8/150: 65% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21)
3:46.715 finish M dispatch Fluffy_Pillow 98.6/150: 66% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
3:47.518 build E pistol_shot Fluffy_Pillow 110.4/150: 74% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
3:48.323 build F sinister_strike Fluffy_Pillow 117.2/150: 78% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
3:49.127 build F sinister_strike Fluffy_Pillow 118.9/150: 79% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
3:49.931 finish M dispatch Fluffy_Pillow 120.6/150: 80% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
3:50.734 build F sinister_strike Fluffy_Pillow 122.1/150: 81% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
3:51.537 build E pistol_shot Fluffy_Pillow 123.6/150: 82% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
3:52.342 finish M dispatch Fluffy_Pillow 130.1/150: 87% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
3:53.146 build F sinister_strike Fluffy_Pillow 121.5/150: 81% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
3:53.951 build E pistol_shot Fluffy_Pillow 112.8/150: 75% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
3:54.756 finish M dispatch Fluffy_Pillow 129.2/150: 86% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(2)
3:55.559 build F sinister_strike Fluffy_Pillow 140.5/150: 94% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(2)
3:56.364 build F sinister_strike Fluffy_Pillow 121.8/150: 81% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(2)
3:57.168 build F sinister_strike Fluffy_Pillow 123.0/150: 82% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(2)
3:57.973 finish M dispatch Fluffy_Pillow 114.2/150: 76% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(2)
3:58.777 build E pistol_shot Fluffy_Pillow 115.3/150: 77% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(2)
3:59.581 build F sinister_strike Fluffy_Pillow 131.3/150: 88% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(2)
4:00.386 build F sinister_strike Fluffy_Pillow 122.3/150: 82% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(2)
4:01.192 finish M dispatch Fluffy_Pillow 123.4/150: 82% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
4:01.998 build F sinister_strike Fluffy_Pillow 124.4/150: 83% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
4:02.802 build F sinister_strike Fluffy_Pillow 115.3/150: 77% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
4:03.606 finish M dispatch Fluffy_Pillow 90.2/150: 60% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(3)
4:04.611 build E pistol_shot Fluffy_Pillow 85.4/150: 57% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(3)
4:05.616 build F sinister_strike Fluffy_Pillow 85.6/150: 57% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(3)
4:06.621 finish M dispatch Fluffy_Pillow 90.7/150: 60% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:07.626 build E pistol_shot Fluffy_Pillow 75.8/150: 51% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:08.630 build F sinister_strike Fluffy_Pillow 76.5/150: 51% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:09.634 cds I killing_spree Fluffy_Pillow 62.7/150: 42% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:11.936 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:12.941 build E pistol_shot Fluffy_Pillow 146.2/150: 97% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:13.946 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:14.951 build F sinister_strike Fluffy_Pillow 136.2/150: 91% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:15.955 finish M dispatch Fluffy_Pillow 122.3/150: 82% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:16.959 build E pistol_shot Fluffy_Pillow 128.4/150: 86% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:17.964 build F sinister_strike Fluffy_Pillow 139.4/150: 93% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection
4:18.969 finish M dispatch Fluffy_Pillow 135.3/150: 90% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
4:19.973 build E pistol_shot Fluffy_Pillow 131.0/150: 87% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
4:20.976 build F sinister_strike Fluffy_Pillow 141.6/150: 94% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(22)
4:21.980 finish M dispatch Fluffy_Pillow 117.4/150: 78% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
4:22.984 build E pistol_shot Fluffy_Pillow 113.1/150: 75% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
4:23.990 build F sinister_strike Fluffy_Pillow 113.8/150: 76% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
4:24.995 finish K roll_the_bones Fluffy_Pillow 119.6/150: 80% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
4:25.998 build E pistol_shot Fluffy_Pillow 125.2/150: 83% energy | 1.0/5: 20% combo_points opportunity, broadside, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
4:27.004 finish K roll_the_bones Fluffy_Pillow 125.9/150: 84% energy | 4.0/5: 80% combo_points broadside, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
4:28.010 build F sinister_strike Fluffy_Pillow 131.4/150: 88% energy | 1.0/5: 20% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
4:29.013 finish M dispatch Fluffy_Pillow 136.9/150: 91% energy | 5.0/5: 100% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
4:30.018 build E pistol_shot Fluffy_Pillow 122.4/150: 82% energy | 1.0/5: 20% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
4:31.021 finish M dispatch Fluffy_Pillow 132.7/150: 88% energy | 4.0/5: 80% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
4:32.025 build F sinister_strike Fluffy_Pillow 118.0/150: 79% energy | 1.0/5: 20% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(10)
4:33.029 finish M dispatch Fluffy_Pillow 113.2/150: 75% energy | 5.0/5: 100% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
4:34.033 build E pistol_shot Fluffy_Pillow 98.5/150: 66% energy | 1.0/5: 20% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(2)
4:35.038 finish M dispatch Fluffy_Pillow 108.7/150: 72% energy | 4.0/5: 80% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(2)
4:36.042 build F sinister_strike Fluffy_Pillow 103.9/150: 69% energy | 1.0/5: 20% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(3)
4:37.047 finish M dispatch Fluffy_Pillow 89.1/150: 59% energy | 5.0/5: 100% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(3)
4:38.051 build E pistol_shot Fluffy_Pillow 74.2/150: 49% energy | 1.0/5: 20% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(3)
4:39.056 finish M dispatch Fluffy_Pillow 84.3/150: 56% energy | 4.0/5: 80% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(3)
4:40.061 build F sinister_strike Fluffy_Pillow 69.3/150: 46% energy | 1.0/5: 20% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(3)
4:41.066 finish M dispatch Fluffy_Pillow 64.3/150: 43% energy | 5.0/5: 100% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(3)
4:42.071 build E pistol_shot Fluffy_Pillow 59.4/150: 40% energy | 1.0/5: 20% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), galeforce_striking, quick_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:43.076 finish M dispatch Fluffy_Pillow 69.4/150: 46% energy | 4.0/5: 80% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:44.080 build F sinister_strike Fluffy_Pillow 54.5/150: 36% energy | 1.0/5: 20% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:45.085 finish M dispatch Fluffy_Pillow 39.8/150: 27% energy | 5.0/5: 100% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:46.090 build E pistol_shot Fluffy_Pillow 25.0/150: 17% energy | 1.0/5: 20% combo_points opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:47.094 finish M dispatch Fluffy_Pillow 35.3/150: 24% energy | 4.0/5: 80% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:48.099 cds H adrenaline_rush Fluffy_Pillow 30.6/150: 20% energy | 0.0/5: 0% combo_points broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:49.104 build F sinister_strike Fluffy_Pillow 73.2/150: 49% energy | 0.0/5: 0% combo_points adrenaline_rush, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:49.908 finish M dispatch Fluffy_Pillow 54.2/150: 36% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:50.711 build E pistol_shot Fluffy_Pillow 55.2/150: 37% energy | 0.0/5: 0% combo_points adrenaline_rush, opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:51.515 cds I killing_spree Fluffy_Pillow 61.4/150: 41% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:53.908 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:54.713 finish M dispatch Fluffy_Pillow 141.2/150: 94% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:55.517 build E pistol_shot Fluffy_Pillow 132.4/150: 88% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:56.322 finish M dispatch Fluffy_Pillow 138.6/150: 92% energy | 4.0/5: 80% combo_points adrenaline_rush, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:57.127 build F sinister_strike Fluffy_Pillow 129.8/150: 87% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:57.932 finish M dispatch Fluffy_Pillow 131.0/150: 87% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:58.737 build E pistol_shot Fluffy_Pillow 132.2/150: 88% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:59.539 finish M dispatch Fluffy_Pillow 138.3/150: 92% energy | 4.0/5: 80% combo_points adrenaline_rush, broadside, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)

Stats

Level Bonus (120) Race Bonus (dwarf) Raid-Buffed Unbuffed Gear Amount
Strength 1467 2 1529 1469 0
Agility 1467 -2 6562 6144 4387 (3433)
Stamina 1001 1 9027 8207 7205
Intellect 1467 -1 1678 1466 0
Spirit 0 0 0 0 0
Health 180540 164140 0
Energy 150 150 0
Combo Points 5 5 0
Crit 20.72% 20.72% 772
Haste 17.75% 17.75% 1207
Damage / Heal Versatility 3.56% 3.56% 303
Attack Power 7218 6144 0
Mastery 23.40% 23.40% 720
Armor 1897 1897 1897
Run Speed 9 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Replicated Chitin Cord
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Quarantine Protocol Treads
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +104 Haste, +80 Vers }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Lancet of the Deft Hand
ilevel: 385, weapon: { 400 - 571, 2.6 }, stats: { +164 Agi, +277 Sta, +68 Mastery, +54 Vers }, enchant: galeforce_striking
Local Off Hand Lancet of the Deft Hand
ilevel: 385, weapon: { 400 - 571, 2.6 }, stats: { +164 Agi, +277 Sta, +68 Mastery, +54 Vers }, enchant: quick_navigation

Talents

Level
15 Weaponmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue) Ghostly Strike (Outlaw Rogue)
30 Acrobatic Strikes (Outlaw Rogue) Retractable Hook (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Iron Stomach (Outlaw Rogue) Cheat Death Elusiveness
75 Dirty Tricks (Outlaw Rogue) Blinding Powder (Outlaw Rogue) Prey on the Weak
90 Loaded Dice (Outlaw Rogue) Alacrity (Outlaw Rogue) Slice and Dice (Outlaw Rogue)
100 Dancing Steel (Outlaw Rogue) Blade Rush (Outlaw Rogue) Killing Spree (Outlaw Rogue)

Profile

rogue="T22_Rogue_Outlaw"
spec=outlaw
level=120
race=dwarf
role=attack
position=back
talents=2310023

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion
actions.precombat+=/marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,precombat_seconds=2
actions.precombat+=/slice_and_dice,precombat_seconds=2
actions.precombat+=/adrenaline_rush,precombat_seconds=1

# Executed every time the actor is available.
# Reroll for 2+ buffs with Loaded Dice up. Otherwise reroll for 2+ or Grand Melee or Ruthless Precision.
actions=variable,name=rtb_reroll,value=rtb_buffs<2&(buff.loaded_dice.up|!buff.grand_melee.up&!buff.ruthless_precision.up)
actions+=/variable,name=ambush_condition,value=combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&cooldown.ghostly_strike.remains<1)+buff.broadside.up&energy>60&!buff.skull_and_crossbones.up
# With multiple targets, this variable is checked to decide whether some CDs should be synced with Blade Flurry
actions+=/variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.up
actions+=/call_action_list,name=stealth,if=stealthed.all
actions+=/call_action_list,name=cds
# Finish at maximum CP. Substract one for each Broadside and Opportunity when Quick Draw is selected and MfD is not ready after the next second.
actions+=/call_action_list,name=finish,if=combo_points>=cp_max_spend-(buff.broadside.up+buff.opportunity.up)*(talent.quick_draw.enabled&(!talent.marked_for_death.enabled|cooldown.marked_for_death.remains>1))
actions+=/call_action_list,name=build
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen
actions+=/arcane_pulse
actions+=/lights_judgment

actions.build=pistol_shot,if=combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
actions.build+=/sinister_strike

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.time_to_max>1
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15-buff.adrenaline_rush.up*5)&!stealthed.rogue&combo_points.deficit>=cp_max_spend-1)
# Blade Flurry on 2+ enemies. With adds: Use if they stay for 8+ seconds or if your next charge will be ready in time for the next wave.
actions.cds+=/blade_flurry,if=spell_targets>=2&!buff.blade_flurry.up&(!raid_event.adds.exists|raid_event.adds.remains>8|cooldown.blade_flurry.charges=1&raid_event.adds.in>(2-cooldown.blade_flurry.charges_fractional)*25)
actions.cds+=/ghostly_strike,if=variable.blade_flurry_sync&combo_points.deficit>=1+buff.broadside.up
actions.cds+=/killing_spree,if=variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
actions.cds+=/blade_rush,if=variable.blade_flurry_sync&energy.time_to_max>1
# Using Vanish/Ambush is only a very tiny increase, so in reality, you're absolutely fine to use it as a utility spell.
actions.cds+=/vanish,if=!stealthed.all&variable.ambush_condition
actions.cds+=/shadowmeld,if=!stealthed.all&variable.ambush_condition

actions.finish=slice_and_dice,if=buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions.finish+=/roll_the_bones,if=(buff.roll_the_bones.remains<=3|variable.rtb_reroll)&(target.time_to_die>20|buff.roll_the_bones.remains<target.time_to_die)
# BTE with the Ruthless Precision buff from RtB or with the Ace Up Your Sleeve or Deadshot traits.
actions.finish+=/between_the_eyes,if=buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
actions.finish+=/dispatch

actions.stealth=ambush

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=replicated_chitin_cord,id=160717,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=quarantine_protocol_treads,id=160624,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=lancet_of_the_deft_hand,id=160693,bonus_id=4800/1507,enchant=galeforce_striking
off_hand=lancet_of_the_deft_hand,id=160693,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=772
# gear_haste_rating=1207
# gear_mastery_rating=720
# gear_versatility_rating=303
# gear_armor=1897

T22_Rogue_Subtlety : 17261 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17261.0 17261.0 11.2 / 0.065% 1918.4 / 11.1% 675.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
25.5 25.3 Energy 18.94% 57.4 100.0% 100%
Talents
  • 15: Find Weakness (Subtlety Rogue)
  • 30: Shadow Focus (Subtlety Rogue)
  • 45: Marked for Death
  • 90: Enveloping Shadows (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Subtlety 17261
auto_attack_mh 1954 11.3% 236.3 1.27sec 2478 1964 Direct 236.3 2352 4703 2478 24.4% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 236.35 236.35 0.00 0.00 1.2619 0.0000 585676.18 753478.50 22.27 1963.74 1963.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.62 56.54% 2351.58 1895 2986 2351.95 2292 2424 314222 404231 22.26
crit 57.72 24.42% 4702.64 3789 5973 4703.43 4469 4960 271454 349247 22.27
miss 45.00 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 970 5.6% 234.7 1.28sec 1239 975 Direct 234.7 1176 2352 1239 24.4% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 234.72 234.72 0.00 0.00 1.2711 0.0000 290857.63 374235.86 22.28 974.87 974.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.93 56.63% 1175.72 947 1493 1175.89 1144 1214 156288 201094 22.28
crit 57.22 24.38% 2351.89 1895 2986 2352.27 2249 2468 134570 173142 22.28
miss 44.58 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Backstab 1555 9.0% 66.2 4.24sec 7047 7015 Direct 66.2 5667 11336 7047 24.3% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.19 66.19 0.00 0.00 1.0045 0.0000 466413.39 608224.65 23.32 7015.42 7015.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.08 75.66% 5667.43 4258 7593 5668.54 5394 5973 283824 370121 23.31
crit 16.11 24.34% 11336.36 8545 15187 11339.08 10251 12684 182590 238103 23.31
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${{$s2=0}*$<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Eviscerate 6708 38.9% 62.5 4.79sec 32135 31991 Direct 62.5 25826 51679 32135 24.4% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.53 62.53 0.00 0.00 1.0045 0.0000 2009315.98 2571274.60 21.86 31991.40 31991.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.27 75.60% 25825.75 12811 38158 25828.91 24064 27971 1220720 1562162 21.86
crit 15.26 24.40% 51678.78 25622 76315 51681.77 42987 59808 788596 1009112 21.86
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow 244 1.4% 3.1 80.31sec 23790 0 Direct 3.1 19129 38257 23789 24.4% 0.0%  

Stats details: frenetic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.08 3.08 0.00 0.00 0.0000 0.0000 73364.92 104883.96 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.33 75.63% 19128.89 19082 19617 18389.50 0 19617 44617 63785 28.89
crit 0.75 24.37% 38257.31 38164 39233 21421.55 0 39233 28748 41098 16.83
 
 

Action details: frenetic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=12846} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:25774.82
  • base_dd_max:25774.82
 
Nightblade 2107 12.2% 19.8 15.08sec 31905 31763 Periodic 180.0 2822 5645 3508 24.3% 0.0% 96.9%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.80 0.00 180.04 180.04 1.0045 1.6154 631643.48 631643.48 0.00 2032.85 31763.22
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.3 75.68% 2821.89 1 3988 2822.25 2733 2925 384511 384511 0.00
crit 43.8 24.32% 5644.73 3 7975 5645.41 5085 6013 247133 247133 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Healing effects reduced by {$s7=15}%. Taking {$s6=15}% increased damage from the Rogue.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and reduces the effectiveness of healing on the target by {$s7=15}%. Lasts longer per combo point. 1 point : ${$<damage>*8/6} over 8 sec 2 points: ${$<damage>*10/6} over 10 sec 3 points: ${$<damage>*12/6} over 12 sec 4 points: ${$<damage>*14/6} over 14 sec 5 points: ${$<damage>*16/6} over 16 sec{$?s193531=false}[ 6 points: ${$<damage>*18/6} over 18 sec][] You deal {$s6=15}% increased damage to enemies afflicted by your Nightblade.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.126126
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Shadow Blades 0 (406) 0.0% (2.3%) 2.0 180.29sec 59960 119396

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.5026 0.0000 0.00 0.00 0.00 119395.88 119395.88
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Combo point generating abilities generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow.
  • description:Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.
 
    Shadow Blades (_attack) 406 2.3% 22.1 9.77sec 5424 0 Direct 22.1 5424 0 5424 0.0% 0.0%  

Stats details: shadow_blades_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.12 22.12 0.00 0.00 0.0000 0.0000 119992.86 119992.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.12 100.00% 5424.24 2204 13447 5424.14 4091 7182 119993 119993 0.00
 
 

Action details: shadow_blades_attack

Static Values
  • id:279043
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3211.51
  • base_dd_max:3211.51
 
Shadowstrike 3318 19.2% 89.0 3.40sec 11171 11121 Direct 89.0 8989 17977 11171 24.3% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.00 89.00 0.00 0.00 1.0045 0.0000 994248.96 1267072.16 21.53 11121.23 11121.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.39 75.72% 8989.29 6246 13447 8989.56 8711 9339 605820 772064 21.53
crit 21.61 24.28% 17976.65 12492 26893 17976.31 16511 19382 388429 495008 21.53
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stealth.up
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage.$?a231718[ While Stealthed, you strike through the shadows and appear behind your target up to ${5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage.][] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Subtlety
Arcane Torrent 3.4 91.14sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.35 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:25046
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy.deficit>=15+energy.regen
Spelldata
  • id:25046
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within $A1 yards and restore $m2 Energy.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
Marked for Death 9.8 34.15sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=5} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 23.0 13.31sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=5 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=20}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Symbols of Death 10.3 30.29sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.nightblade.ticking
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=15}%.
  • description:Invoke ancient symbols of power, generating {$s5=40} Energy and increasing your damage done by {$s1=15}% for {$d=10 seconds}.
 
Vanish 2.3 131.45sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!variable.shd_threshold&debuff.find_weakness.remains<1
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:27.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=4}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 202.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 75.5sec 66.7sec 8.95% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_crit_1:8.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.8sec 65.8sec 9.00% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_haste_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.7 0.2 74.3sec 65.3sec 9.10% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 74.6sec 65.6sec 9.04% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Frothing Rage 4.8 10.8 66.5sec 18.9sec 75.38% 0.00% 0.0(0.0) 0.9

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:28.55%
  • frothing_rage_2:25.11%
  • frothing_rage_3:21.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Gale-Force Striking 7.1 4.3 42.2sec 25.0sec 44.23% 0.00% 4.3(4.3) 6.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_galeforce_striking
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • galeforce_striking_1:44.23%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267612
  • name:Gale-Force Striking
  • tooltip:Increases attack speed by $s%.
  • description:{$@spelldesc255141=Permanently enchant a weapon to sometimes increase your attack speed by $267612s% for {$267612d=15 seconds} when using melee or ranged attacks and abilities.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Master of Shadows 25.1 0.1 12.1sec 12.1sec 25.14% 0.00% 150.6(150.6) 24.9

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_master_of_shadows
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • master_of_shadows_1:25.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196980
  • name:Master of Shadows
  • tooltip:Regenerating ${{$s1=4}*{$d=3 seconds}/$t1+{$s2=1}} Energy over {$d=3 seconds}.
  • description:{$@spelldesc196976=Gain ${{$196980s1=4}*{$196980d=3 seconds}/$196980t1+{$196980s2=1}} Energy over {$196980d=3 seconds} when you enter Stealth or activate Shadow Dance.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Masterful Navigation 6.2 23.1 52.0sec 10.4sec 68.86% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:18.00%
  • masterful_navigation_2:17.49%
  • masterful_navigation_3:17.01%
  • masterful_navigation_4:16.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.10% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:18.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 0.0 62.3sec 40.0sec 35.78% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.41%
  • overwhelming_power_4:1.41%
  • overwhelming_power_5:1.42%
  • overwhelming_power_6:1.42%
  • overwhelming_power_7:1.43%
  • overwhelming_power_8:1.43%
  • overwhelming_power_9:1.44%
  • overwhelming_power_10:1.44%
  • overwhelming_power_11:1.45%
  • overwhelming_power_12:1.45%
  • overwhelming_power_13:1.46%
  • overwhelming_power_14:1.46%
  • overwhelming_power_15:1.47%
  • overwhelming_power_16:1.47%
  • overwhelming_power_17:1.48%
  • overwhelming_power_18:1.48%
  • overwhelming_power_19:1.49%
  • overwhelming_power_20:1.49%
  • overwhelming_power_21:1.49%
  • overwhelming_power_22:1.50%
  • overwhelming_power_23:1.50%
  • overwhelming_power_24:1.53%
  • overwhelming_power_25:0.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades 2.0 0.0 179.8sec 180.2sec 13.18% 14.43% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadow_blades_1:13.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Combo point generating abilities generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow.
  • description:Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Shadow Dance 23.0 0.0 13.3sec 13.3sec 38.03% 41.77% 0.0(0.0) 22.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadow_dance_1:38.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=5 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=20}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:5.00
  • cooldown:1.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 1.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Symbols of Death 10.3 0.0 30.3sec 30.3sec 33.87% 36.60% 0.0(0.0) 10.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • symbols_of_death_1:33.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=15}%.
  • description:Invoke ancient symbols of power, generating {$s5=40} Energy and increasing your damage done by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Titanic Overcharge 12.4 33.2 24.8sec 6.6sec 84.87% 0.00% 3.6(3.6) 11.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:38.83

Stack Uptimes

  • titanic_overcharge_1:23.16%
  • titanic_overcharge_2:16.86%
  • titanic_overcharge_3:12.19%
  • titanic_overcharge_4:8.89%
  • titanic_overcharge_5:6.52%
  • titanic_overcharge_6:4.72%
  • titanic_overcharge_7:3.39%
  • titanic_overcharge_8:9.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=34} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 26.2 27.2 11.6sec 5.6sec 66.70% 0.00% 1.8(1.8) 25.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.72%
  • unstable_flames_2:16.72%
  • unstable_flames_3:8.42%
  • unstable_flames_4:4.31%
  • unstable_flames_5:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 2.3 0.0 131.7sec 131.7sec 0.01% 2.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Subtlety
backstab Energy 66.2 2316.5 35.0 35.0 201.3
eviscerate Energy 62.5 2012.1 32.2 32.2 998.6
eviscerate Combo Points 62.5 292.4 4.7 4.7 6872.5
nightblade Energy 19.8 481.6 24.3 24.3 1311.6
nightblade Combo Points 19.8 91.1 4.6 4.6 6930.0
shadowstrike Energy 89.0 2848.0 32.0 32.0 349.1
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 9.82 48.93 (12.68%) 4.98 0.15 0.31%
arcane_torrent Energy 3.35 50.26 (0.66%) 15.00 0.00 0.00%
backstab Combo Points 66.19 66.19 (17.15%) 1.00 0.00 0.00%
symbols_of_death Energy 10.28 365.08 (4.81%) 35.52 46.03 11.20%
shadowstrike Combo Points 89.00 176.00 (45.61%) 1.98 2.00 1.12%
energy_regen Energy 1157.41 3597.98 (47.39%) 3.11 54.83 1.50%
Shadow Techniques Energy 84.38 672.34 (8.86%) 7.97 2.74 0.41%
Shadow Techniques Combo Points 84.38 77.87 (20.18%) 0.92 6.52 7.73%
Master of Shadows Energy 175.73 605.56 (7.98%) 3.45 21.56 3.44%
Shadow Blades Combo Points 22.12 16.87 (4.37%) 0.76 5.25 23.75%
Relentless Strikes Energy 82.32 2300.65 (30.30%) 27.95 0.44 0.02%
Resource RPS-Gain RPS-Loss
Energy 25.31 25.53
Combo Points 1.29 1.28
Combat End Resource Mean Min Max
Energy 33.96 0.01 100.00
Combo Points 2.33 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.7%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Subtlety Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Subtlety Damage Per Second
Count 7499
Mean 17260.96
Minimum 15622.78
Maximum 19272.21
Spread ( max - min ) 3649.43
Range [ ( max - min ) / 2 * 100% ] 10.57%
Standard Deviation 494.4872
5th Percentile 16486.04
95th Percentile 18119.49
( 95th Percentile - 5th Percentile ) 1633.46
Mean Distribution
Standard Deviation 5.7102
95.00% Confidence Intervall ( 17249.77 - 17272.15 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3153
0.1 Scale Factor Error with Delta=300 2088
0.05 Scale Factor Error with Delta=300 8350
0.01 Scale Factor Error with Delta=300 208735
Priority Target DPS
Sample Data T22_Rogue_Subtlety Priority Target Damage Per Second
Count 7499
Mean 17260.96
Minimum 15622.78
Maximum 19272.21
Spread ( max - min ) 3649.43
Range [ ( max - min ) / 2 * 100% ] 10.57%
Standard Deviation 494.4872
5th Percentile 16486.04
95th Percentile 18119.49
( 95th Percentile - 5th Percentile ) 1633.46
Mean Distribution
Standard Deviation 5.7102
95.00% Confidence Intervall ( 17249.77 - 17272.15 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3153
0.1 Scale Factor Error with Delta=300 2088
0.05 Scale Factor Error with Delta=300 8350
0.01 Scale Factor Error with Delta=300 208735
DPS(e)
Sample Data T22_Rogue_Subtlety Damage Per Second (Effective)
Count 7499
Mean 17260.96
Minimum 15622.78
Maximum 19272.21
Spread ( max - min ) 3649.43
Range [ ( max - min ) / 2 * 100% ] 10.57%
Damage
Sample Data T22_Rogue_Subtlety Damage
Count 7499
Mean 5171513.40
Minimum 3953717.10
Maximum 6452646.21
Spread ( max - min ) 2498929.10
Range [ ( max - min ) / 2 * 100% ] 24.16%
DTPS
Sample Data T22_Rogue_Subtlety Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Subtlety Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Subtlety Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Subtlety Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Subtlety Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Subtlety Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_SubtletyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Subtlety Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=stealth_threshold,value=60+talent.vigor.enabled*35+talent.master_of_shadows.enabled*10
Used to define when to use stealth CDs or builders
5 0.00 stealth
6 0.00 marked_for_death,precombat_seconds=15
7 0.00 shadow_blades,precombat_seconds=1
8 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 call_action_list,name=cds
Check CDs at first
A 0.00 run_action_list,name=stealthed,if=stealthed.all
Run fully switches to the Stealthed Rotation (by doing so, it forces pooling if nothing is available).
B 6.54 nightblade,if=target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
Apply Nightblade at 2+ CP during the first 10 seconds, after that 4+ CP if it expires within the next GCD or is not up
C 0.00 call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&combo_points.deficit>=4
Consider using a Stealth CD when reaching the energy threshold and having space for at least 4 CP
D 0.00 call_action_list,name=finish,if=combo_points>=4+talent.deeper_stratagem.enabled|target.time_to_die<=1&combo_points>=3
Finish at 4+ without DS, 5+ with DS (outside stealth)
E 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold-40*!(talent.alacrity.enabled|talent.shadow_focus.enabled|talent.master_of_shadows.enabled)
Use a builder when reaching the energy threshold (minus 40 if none of Alacrity, Shadow Focus, and Master of Shadows is selected)
F 3.35 arcane_torrent,if=energy.deficit>=15+energy.regen
Lowest priority in all of the APL because it causes a GCD
0.00 arcane_pulse
0.00 lights_judgment
actions.build
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2|buff.the_dreadlords_deceit.stack>=29
0.00 gloomblade
G 66.19 backstab
actions.cds
# count action,conditions
H 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|(buff.vanish.up&(buff.shadow_blades.up|cooldown.shadow_blades.remains<=30))
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
I 10.28 symbols_of_death,if=dot.nightblade.ticking
J 0.27 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit
K 8.55 marked_for_death,if=raid_event.adds.in>30&!stealthed.all&combo_points.deficit>=cp_max_spend
L 1.00 shadow_blades,if=combo_points.deficit>=2+stealthed.all
0.00 shuriken_tornado,if=spell_targets>=3&dot.nightblade.ticking&buff.symbols_of_death.up&buff.shadow_dance.up
M 0.68 shadow_dance,if=!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled
actions.finish
# count action,conditions
N 8.44 nightblade,if=(!talent.dark_shadow.enabled|!buff.shadow_dance.up)&target.time_to_die-remains>6&remains<tick_time*2&(spell_targets.shuriken_storm<4|!buff.symbols_of_death.up)
Keep up Nightblade if it is about to run out. Do not use NB during Dance, if talented into Dark Shadow.
0.00 nightblade,cycle_targets=1,if=spell_targets.shuriken_storm>=2&(spell_targets.shuriken_storm<=5|talent.secret_technique.enabled)&!buff.shadow_dance.up&target.time_to_die>=(5+(2*combo_points))&refreshable
Multidotting outside Dance on targets that will live for the duration of Nightblade with refresh during pandemic if you have less than 6 targets or play with Secret Technique.
O 4.82 nightblade,if=remains<cooldown.symbols_of_death.remains+10&cooldown.symbols_of_death.remains<=5&target.time_to_die-remains>cooldown.symbols_of_death.remains+5
Refresh Nightblade early if it will expire during Symbols. Do that refresh if SoD gets ready in the next 5s.
0.00 secret_technique,if=buff.symbols_of_death.up&(!talent.dark_shadow.enabled|spell_targets.shuriken_storm<2|buff.shadow_dance.up)
Secret Technique during Symbols. With Dark Shadow and multiple targets also only during Shadow Dance (until threshold in next line).
0.00 secret_technique,if=spell_targets.shuriken_storm>=2+talent.dark_shadow.enabled+talent.nightstalker.enabled
With enough targets always use SecTec on CD.
P 62.53 eviscerate
actions.stealth_cds
# count action,conditions
0.00 variable,name=shd_threshold,value=cooldown.shadow_dance.charges_fractional>=1.75
Helper Variable
Q 2.26 vanish,if=!variable.shd_threshold&debuff.find_weakness.remains<1
Vanish unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
0.00 pool_resource,for_next=1,extra_amount=40
Pool for Shadowmeld + Shadowstrike unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
0.00 shadowmeld,if=energy>=40&energy.deficit>=10&!variable.shd_threshold&debuff.find_weakness.remains<1
R 21.92 shadow_dance,if=(!talent.dark_shadow.enabled|dot.nightblade.remains>=5+talent.subterfuge.enabled)&(variable.shd_threshold|buff.symbols_of_death.remains>=1.2|spell_targets>=4&cooldown.symbols_of_death.remains>10)
With Dark Shadow only Dance when Nightblade will stay up. Use during Symbols or above threshold.
S 0.40 shadow_dance,if=target.time_to_die<cooldown.symbols_of_death.remains
actions.stealthed
# count action,conditions
T 1.00 shadowstrike,if=buff.stealth.up
If stealth is up, we really want to use Shadowstrike to benefits from the passive bonus, even if we are at max cp (from the precombat MfD).
U 0.00 call_action_list,name=finish,if=combo_points.deficit<=1-(talent.deeper_stratagem.enabled&buff.vanish.up)
Finish at 4+ CP without DS, 5+ with DS, and 6 with DS after Vanish
0.00 shadowstrike,cycle_targets=1,if=talent.secret_technique.enabled&talent.find_weakness.enabled&debuff.find_weakness.remains<1&spell_targets.shuriken_storm=2&target.time_to_die-remains>6
At 2 targets with Secret Technique keep up Find Weakness by cycling Shadowstrike.
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=3
V 88.00 shadowstrike

Sample Sequence

01245678TBIRVPVPVPRVVPVPRVPVVPKBGGGPGGFPRVVOVVIPRVVPVVPRVVPVVPGGGBKPGGGOQVGGIPRVVPVVPRVVPVVNGGGPKPGGOGIRVPVVPRVVPVVPGGBGGGFPGGNGIGPKPRVVPVVPGGGBGGGPRVVNVIVPKPRVVPVVPGGGBGGGPGGLNRVVIPVPKPRVVPVVPGGNGGPQVGPRVVPVVFNGIGGPKPRVVPVVPGGBGGGPRVVHNVVIPRVVPVVPKPRVVPVVNGGGPGGOGGIGPRVVPVVPKPSVVNVVPSVVPVVPGG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth
Pre precombat 7 shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades
Pre precombat 8 potion Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades, battle_potion_of_agility
0:00.000 stealthed T shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.004 default B nightblade Fluffy_Pillow 79.5/100: 79% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.007 cds I symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.007 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.007 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:03.012 finish P eviscerate Fluffy_Pillow 90.9/100: 91% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:04.017 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:05.021 finish P eviscerate Fluffy_Pillow 99.0/100: 99% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:06.027 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:07.031 finish P eviscerate Fluffy_Pillow 91.0/100: 91% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:08.035 stealth_cds R shadow_dance Fluffy_Pillow 94.9/100: 95% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:08.035 stealthed V shadowstrike Fluffy_Pillow 95.9/100: 96% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:09.040 stealthed V shadowstrike Fluffy_Pillow 86.9/100: 87% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:10.045 finish P eviscerate Fluffy_Pillow 85.9/100: 86% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:11.050 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:12.054 finish P eviscerate Fluffy_Pillow 83.0/100: 83% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:13.059 stealth_cds R shadow_dance Fluffy_Pillow 93.9/100: 94% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:13.059 stealthed V shadowstrike Fluffy_Pillow 94.9/100: 95% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:14.064 finish P eviscerate Fluffy_Pillow 93.9/100: 94% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, battle_potion_of_agility
0:15.070 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation(2), archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:16.074 stealthed V shadowstrike Fluffy_Pillow 90.8/100: 91% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, frothing_rage(2), masterful_navigation(2), archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:17.081 finish P eviscerate Fluffy_Pillow 81.7/100: 82% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, shadow_dance, frothing_rage(2), masterful_navigation(2), archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:18.086 cds K marked_for_death Fluffy_Pillow 98.5/100: 99% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, frothing_rage(2), masterful_navigation(3), archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:18.086 default B nightblade Fluffy_Pillow 98.5/100: 99% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage(2), masterful_navigation(3), archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:19.091 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage(2), masterful_navigation(3), archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:20.096 build G backstab Fluffy_Pillow 87.8/100: 88% energy | 2.0/5: 40% combo_points bloodlust, frothing_rage(2), masterful_navigation(3), archive_of_the_titans(5), resounding_protection, battle_potion_of_agility
0:21.102 build G backstab Fluffy_Pillow 67.7/100: 68% energy | 3.0/5: 60% combo_points bloodlust, frothing_rage(2), masterful_navigation(3), archive_of_the_titans(5), resounding_protection, battle_potion_of_agility
0:22.106 finish P eviscerate Fluffy_Pillow 47.5/100: 47% energy | 4.0/5: 80% combo_points bloodlust, frothing_rage(2), masterful_navigation(3), archive_of_the_titans(5), resounding_protection, battle_potion_of_agility
0:23.112 build G backstab Fluffy_Pillow 59.3/100: 59% energy | 1.0/5: 20% combo_points bloodlust, frothing_rage(2), masterful_navigation(3), archive_of_the_titans(5), resounding_protection, titanic_overcharge
0:24.116 build G backstab Fluffy_Pillow 39.2/100: 39% energy | 2.0/5: 40% combo_points bloodlust, frothing_rage(2), masterful_navigation(3), elemental_whirl_crit, archive_of_the_titans(5), resounding_protection, titanic_overcharge
0:25.121 default F arcane_torrent Fluffy_Pillow 27.2/100: 27% energy | 4.0/5: 80% combo_points bloodlust, frothing_rage(2), masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(6), resounding_protection, titanic_overcharge(2)
0:26.125 finish P eviscerate Fluffy_Pillow 57.1/100: 57% energy | 4.0/5: 80% combo_points bloodlust, frothing_rage(2), masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(6), resounding_protection, titanic_overcharge(2)
0:27.129 stealth_cds R shadow_dance Fluffy_Pillow 61.1/100: 61% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage(2), masterful_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge(3)
0:27.129 stealthed V shadowstrike Fluffy_Pillow 62.1/100: 62% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge(3)
0:28.133 stealthed V shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge(3)
0:29.136 finish O nightblade Fluffy_Pillow 52.3/100: 52% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge(4)
0:30.141 stealthed V shadowstrike Fluffy_Pillow 85.4/100: 85% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, frothing_rage(2), masterful_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge(4)
0:31.147 stealthed V shadowstrike Fluffy_Pillow 68.5/100: 69% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, frothing_rage(2), galeforce_striking, masterful_navigation_final, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(4)
0:32.151 cds I symbols_of_death Fluffy_Pillow 59.7/100: 60% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage(2), galeforce_striking, masterful_navigation_final, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(5)
0:32.151 finish P eviscerate Fluffy_Pillow 99.7/100: 100% energy | 5.0/5: 100% combo_points bloodlust, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation_final, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(5)
0:33.156 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge(5)
0:33.156 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge(5)
0:34.162 stealthed V shadowstrike Fluffy_Pillow 99.2/100: 99% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge(5)
0:35.166 finish P eviscerate Fluffy_Pillow 90.5/100: 90% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation_final, unstable_flames(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge(6)
0:36.172 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_dance, symbols_of_death, frothing_rage(2), galeforce_striking, unstable_flames(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge(6)
0:37.177 stealthed V shadowstrike Fluffy_Pillow 83.3/100: 83% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, symbols_of_death, frothing_rage(2), galeforce_striking, unstable_flames(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge(6)
0:38.183 finish P eviscerate Fluffy_Pillow 66.6/100: 67% energy | 5.0/5: 100% combo_points bloodlust, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation, unstable_flames(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:39.187 stealth_cds R shadow_dance Fluffy_Pillow 77.0/100: 77% energy | 0.0/5: 0% combo_points bloodlust, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation, archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:39.187 stealthed V shadowstrike Fluffy_Pillow 78.0/100: 78% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation, archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:40.193 stealthed V shadowstrike Fluffy_Pillow 77.3/100: 77% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation, archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:41.198 finish P eviscerate Fluffy_Pillow 68.0/100: 68% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:42.204 stealthed V shadowstrike Fluffy_Pillow 97.8/100: 98% energy | 1.0/5: 20% combo_points shadow_dance, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:43.209 stealthed V shadowstrike Fluffy_Pillow 77.6/100: 78% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:44.213 finish P eviscerate Fluffy_Pillow 57.4/100: 57% energy | 5.0/5: 100% combo_points frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:45.217 build G backstab Fluffy_Pillow 64.2/100: 64% energy | 0.0/5: 0% combo_points frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge(7)
0:46.223 build G backstab Fluffy_Pillow 49.0/100: 49% energy | 2.0/5: 40% combo_points frothing_rage(2), masterful_navigation(2), unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge(7)
0:47.230 Waiting     0.800 sec 25.9/100: 26% energy | 3.0/5: 60% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge(7)
0:48.030 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 3.0/5: 60% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans(10), resounding_protection
0:49.033 Waiting     0.524 sec 20.0/100: 20% energy | 5.0/5: 100% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(10), resounding_protection
0:49.557 default B nightblade Fluffy_Pillow 26.2/100: 26% energy | 5.0/5: 100% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(10), resounding_protection
0:50.561 cds K marked_for_death Fluffy_Pillow 42.9/100: 43% energy | 0.0/5: 0% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(11), resounding_protection
0:50.561 finish P eviscerate Fluffy_Pillow 42.9/100: 43% energy | 5.0/5: 100% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(11), resounding_protection
0:51.565 build G backstab Fluffy_Pillow 49.7/100: 50% energy | 0.0/5: 0% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:52.569 Waiting     0.300 sec 26.5/100: 26% energy | 1.0/5: 20% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:52.869 build G backstab Fluffy_Pillow 38.0/100: 38% energy | 2.0/5: 40% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:53.874 Waiting     1.763 sec 14.8/100: 15% energy | 3.0/5: 60% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:55.637 build G backstab Fluffy_Pillow 35.6/100: 36% energy | 3.0/5: 60% combo_points frothing_rage(3), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:56.642 Waiting     1.072 sec 12.4/100: 12% energy | 4.0/5: 80% combo_points masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:57.714 finish O nightblade Fluffy_Pillow 32.8/100: 33% energy | 5.0/5: 100% combo_points masterful_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(12), resounding_protection, titanic_overcharge(2)
0:58.720 stealth_cds Q vanish Fluffy_Pillow 49.4/100: 49% energy | 0.0/5: 0% combo_points masterful_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(12), resounding_protection, titanic_overcharge(2)
0:58.720 stealthed V shadowstrike Fluffy_Pillow 50.4/100: 50% energy | 0.0/5: 0% combo_points vanish, master_of_shadows, masterful_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(12), resounding_protection, titanic_overcharge(2)
0:59.725 build G backstab Fluffy_Pillow 37.9/100: 38% energy | 2.0/5: 40% combo_points master_of_shadows, masterful_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(12), resounding_protection, titanic_overcharge(3)
1:00.728 Waiting     0.822 sec 22.4/100: 22% energy | 3.0/5: 60% combo_points master_of_shadows, masterful_navigation(2), unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:01.550 build G backstab Fluffy_Pillow 35.9/100: 36% energy | 3.0/5: 60% combo_points master_of_shadows, masterful_navigation(2), unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:02.553 cds I symbols_of_death Fluffy_Pillow 24.5/100: 24% energy | 5.0/5: 100% combo_points masterful_navigation(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:02.553 finish P eviscerate Fluffy_Pillow 64.5/100: 64% energy | 5.0/5: 100% combo_points symbols_of_death, masterful_navigation(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:03.558 stealth_cds R shadow_dance Fluffy_Pillow 71.0/100: 71% energy | 0.0/5: 0% combo_points symbols_of_death, masterful_navigation(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:03.558 stealthed V shadowstrike Fluffy_Pillow 72.0/100: 72% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:04.562 stealthed V shadowstrike Fluffy_Pillow 59.6/100: 60% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:05.566 finish P eviscerate Fluffy_Pillow 47.2/100: 47% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge(3)
1:06.572 stealthed V shadowstrike Fluffy_Pillow 70.8/100: 71% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, masterful_navigation(2), unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge(3)
1:07.578 stealthed V shadowstrike Fluffy_Pillow 50.4/100: 50% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, masterful_navigation(2), unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge(3)
1:08.583 Waiting     0.500 sec 29.9/100: 30% energy | 5.0/5: 100% combo_points symbols_of_death, masterful_navigation(2), unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge(3)
1:09.083 finish P eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/5: 100% combo_points symbols_of_death, masterful_navigation(2), unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge(3)
1:10.088 stealth_cds R shadow_dance Fluffy_Pillow 50.2/100: 50% energy | 1.0/5: 20% combo_points symbols_of_death, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection
1:10.088 stealthed V shadowstrike Fluffy_Pillow 51.2/100: 51% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection
1:11.092 stealthed V shadowstrike Fluffy_Pillow 38.6/100: 39% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(3), archive_of_the_titans(15), resounding_protection
1:12.097 Waiting     0.200 sec 26.0/100: 26% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(3), archive_of_the_titans(15), resounding_protection
1:12.297 finish P eviscerate Fluffy_Pillow 28.2/100: 28% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(3), archive_of_the_titans(15), resounding_protection
1:13.301 stealthed V shadowstrike Fluffy_Pillow 49.6/100: 50% energy | 0.0/5: 0% combo_points shadow_dance, masterful_navigation(3), archive_of_the_titans(15), resounding_protection
1:14.306 Waiting     0.200 sec 29.0/100: 29% energy | 2.0/5: 40% combo_points shadow_dance, masterful_navigation(3), archive_of_the_titans(15), resounding_protection
1:14.506 stealthed V shadowstrike Fluffy_Pillow 39.3/100: 39% energy | 3.0/5: 60% combo_points shadow_dance, masterful_navigation(3), archive_of_the_titans(15), resounding_protection
1:15.511 Waiting     0.652 sec 18.7/100: 19% energy | 5.0/5: 100% combo_points masterful_navigation(3), archive_of_the_titans(16), resounding_protection
1:16.163 finish N nightblade Fluffy_Pillow 26.1/100: 26% energy | 5.0/5: 100% combo_points masterful_navigation(3), archive_of_the_titans(16), resounding_protection, titanic_overcharge
1:17.167 build G backstab Fluffy_Pillow 42.6/100: 43% energy | 0.0/5: 0% combo_points masterful_navigation(3), archive_of_the_titans(16), resounding_protection, titanic_overcharge
1:18.172 Waiting     1.421 sec 19.1/100: 19% energy | 1.0/5: 20% combo_points masterful_navigation(4), archive_of_the_titans(16), resounding_protection, titanic_overcharge
1:19.593 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 1.0/5: 20% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(16), resounding_protection, titanic_overcharge
1:20.596 Waiting     1.364 sec 19.7/100: 20% energy | 3.0/5: 60% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:21.960 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 3.0/5: 60% combo_points masterful_navigation(4), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge(3)
1:22.965 Waiting     2.033 sec 11.9/100: 12% energy | 4.0/5: 80% combo_points masterful_navigation(4), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge(3)
1:24.998 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 4.0/5: 80% combo_points masterful_navigation(4), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge(3)
1:26.003 cds K marked_for_death Fluffy_Pillow 35.9/100: 36% energy | 0.0/5: 0% combo_points masterful_navigation(4), unstable_flames(2), archive_of_the_titans(18), resounding_protection, titanic_overcharge(3)
1:26.003 finish P eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/5: 100% combo_points masterful_navigation(4), unstable_flames(2), archive_of_the_titans(18), resounding_protection, titanic_overcharge(3)
1:27.008 build G backstab Fluffy_Pillow 50.5/100: 51% energy | 1.0/5: 20% combo_points masterful_navigation(4), archive_of_the_titans(18), resounding_protection, titanic_overcharge(3)
1:28.012 Waiting     0.700 sec 27.1/100: 27% energy | 2.0/5: 40% combo_points masterful_navigation(4), archive_of_the_titans(18), resounding_protection, titanic_overcharge(3)
1:28.712 build G backstab Fluffy_Pillow 35.1/100: 35% energy | 2.0/5: 40% combo_points masterful_navigation(4), archive_of_the_titans(18), resounding_protection, titanic_overcharge(3)
1:29.717 Waiting     0.557 sec 19.7/100: 20% energy | 4.0/5: 80% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge(3)
1:30.274 finish O nightblade Fluffy_Pillow 26.1/100: 26% energy | 4.0/5: 80% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge(3)
1:31.279 build G backstab Fluffy_Pillow 36.7/100: 37% energy | 0.0/5: 0% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge(3)
1:32.284 Waiting     1.042 sec 13.2/100: 13% energy | 1.0/5: 20% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection
1:33.326 cds I symbols_of_death Fluffy_Pillow 25.0/100: 25% energy | 1.0/5: 20% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection
1:33.326 stealth_cds R shadow_dance Fluffy_Pillow 65.0/100: 65% energy | 1.0/5: 20% combo_points symbols_of_death, masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection
1:33.326 stealthed V shadowstrike Fluffy_Pillow 66.0/100: 66% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection
1:34.331 finish P eviscerate Fluffy_Pillow 61.4/100: 61% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection
1:35.335 stealthed V shadowstrike Fluffy_Pillow 76.8/100: 77% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection
1:36.340 stealthed V shadowstrike Fluffy_Pillow 64.2/100: 64% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, masterful_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection
1:37.345 finish P eviscerate Fluffy_Pillow 43.6/100: 44% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, masterful_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection
1:38.350 stealth_cds R shadow_dance Fluffy_Pillow 59.1/100: 59% energy | 1.0/5: 20% combo_points symbols_of_death, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:38.350 stealthed V shadowstrike Fluffy_Pillow 60.1/100: 60% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:39.355 stealthed V shadowstrike Fluffy_Pillow 47.5/100: 48% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:40.357 finish P eviscerate Fluffy_Pillow 35.0/100: 35% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:41.360 stealthed V shadowstrike Fluffy_Pillow 56.4/100: 56% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:42.365 stealthed V shadowstrike Fluffy_Pillow 43.9/100: 44% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:43.369 Waiting     1.046 sec 23.3/100: 23% energy | 5.0/5: 100% combo_points masterful_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:44.415 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/5: 100% combo_points masterful_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:45.418 build G backstab Fluffy_Pillow 42.6/100: 43% energy | 0.0/5: 0% combo_points masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
1:46.424 Waiting     0.600 sec 28.0/100: 28% energy | 2.0/5: 40% combo_points masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge
1:47.024 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 2.0/5: 40% combo_points masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
1:48.030 Waiting     1.026 sec 12.6/100: 13% energy | 3.0/5: 60% combo_points masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(21)
1:49.056 default B nightblade Fluffy_Pillow 33.0/100: 33% energy | 4.0/5: 80% combo_points galeforce_striking, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
1:50.060 build G backstab Fluffy_Pillow 44.1/100: 44% energy | 0.0/5: 0% combo_points galeforce_striking, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
1:51.067 Waiting     1.212 sec 21.3/100: 21% energy | 1.0/5: 20% combo_points galeforce_striking, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(18)
1:52.279 build G backstab Fluffy_Pillow 35.8/100: 36% energy | 1.0/5: 20% combo_points galeforce_striking, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(17)
1:53.285 Waiting     1.248 sec 20.8/100: 21% energy | 3.0/5: 60% combo_points galeforce_striking, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(16)
1:54.533 build G backstab Fluffy_Pillow 35.7/100: 36% energy | 3.0/5: 60% combo_points galeforce_striking, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(15)
1:55.538 default F arcane_torrent Fluffy_Pillow 12.7/100: 13% energy | 4.0/5: 80% combo_points galeforce_striking, archive_of_the_titans(20), resounding_protection, overwhelming_power(14)
1:56.543 finish P eviscerate Fluffy_Pillow 39.6/100: 40% energy | 4.0/5: 80% combo_points galeforce_striking, archive_of_the_titans(20), resounding_protection, overwhelming_power(13)
1:57.548 build G backstab Fluffy_Pillow 48.5/100: 48% energy | 1.0/5: 20% combo_points frothing_rage, galeforce_striking, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
1:58.552 Waiting     0.800 sec 25.4/100: 25% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
1:59.352 build G backstab Fluffy_Pillow 42.8/100: 43% energy | 3.0/5: 60% combo_points frothing_rage, galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
2:00.356 Waiting     0.559 sec 19.6/100: 20% energy | 4.0/5: 80% combo_points frothing_rage, galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
2:00.915 finish N nightblade Fluffy_Pillow 26.2/100: 26% energy | 4.0/5: 80% combo_points frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
2:01.921 build G backstab Fluffy_Pillow 44.9/100: 45% energy | 1.0/5: 20% combo_points frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
2:02.924 Waiting     0.287 sec 21.6/100: 22% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge
2:03.211 cds I symbols_of_death Fluffy_Pillow 25.0/100: 25% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
2:03.326 build G backstab Fluffy_Pillow 66.3/100: 66% energy | 2.0/5: 40% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(2)
2:04.330 finish P eviscerate Fluffy_Pillow 51.0/100: 51% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
2:05.335 cds K marked_for_death Fluffy_Pillow 51.7/100: 52% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
2:05.335 finish P eviscerate Fluffy_Pillow 51.7/100: 52% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
2:06.340 stealth_cds R shadow_dance Fluffy_Pillow 58.4/100: 58% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(2)
2:06.340 stealthed V shadowstrike Fluffy_Pillow 59.4/100: 59% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(2)
2:07.346 stealthed V shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(2)
2:08.350 finish P eviscerate Fluffy_Pillow 42.6/100: 43% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(2)
2:09.354 stealthed V shadowstrike Fluffy_Pillow 64.1/100: 64% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:10.358 stealthed V shadowstrike Fluffy_Pillow 43.6/100: 44% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:11.362 Waiting     0.360 sec 23.2/100: 23% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:11.722 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:12.726 build G backstab Fluffy_Pillow 42.1/100: 42% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:13.731 Waiting     1.414 sec 19.0/100: 19% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection
2:15.145 build G backstab Fluffy_Pillow 35.5/100: 36% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection
2:16.150 Waiting     1.686 sec 12.3/100: 12% energy | 2.0/5: 40% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection
2:17.836 build G backstab Fluffy_Pillow 40.1/100: 40% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:18.841 Waiting     0.790 sec 16.9/100: 17% energy | 4.0/5: 80% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:19.631 default B nightblade Fluffy_Pillow 26.2/100: 26% energy | 4.0/5: 80% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:20.635 build G backstab Fluffy_Pillow 37.0/100: 37% energy | 0.0/5: 0% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:21.639 Waiting     1.239 sec 13.9/100: 14% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation(3), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:22.878 build G backstab Fluffy_Pillow 36.1/100: 36% energy | 2.0/5: 40% combo_points frothing_rage, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:23.882 Waiting     1.969 sec 12.7/100: 13% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:25.851 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:26.855 Waiting     1.314 sec 12.1/100: 12% energy | 4.0/5: 80% combo_points frothing_rage, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:28.169 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/5: 100% combo_points frothing_rage, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:29.172 stealth_cds R shadow_dance Fluffy_Pillow 41.9/100: 42% energy | 0.0/5: 0% combo_points frothing_rage, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:29.172 stealthed V shadowstrike Fluffy_Pillow 42.9/100: 43% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:30.177 Waiting     0.200 sec 30.6/100: 31% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:30.377 stealthed V shadowstrike Fluffy_Pillow 32.9/100: 33% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:31.381 finish N nightblade Fluffy_Pillow 20.5/100: 20% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:32.385 stealthed V shadowstrike Fluffy_Pillow 44.1/100: 44% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:33.391 cds I symbols_of_death Fluffy_Pillow 31.8/100: 32% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:33.391 stealthed V shadowstrike Fluffy_Pillow 71.8/100: 72% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:34.396 finish P eviscerate Fluffy_Pillow 51.5/100: 51% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:35.399 cds K marked_for_death Fluffy_Pillow 59.1/100: 59% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(5)
2:35.399 finish P eviscerate Fluffy_Pillow 59.1/100: 59% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(5)
2:36.402 stealth_cds R shadow_dance Fluffy_Pillow 74.6/100: 75% energy | 1.0/5: 20% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(6)
2:36.402 stealthed V shadowstrike Fluffy_Pillow 75.6/100: 76% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(6)
2:37.406 stealthed V shadowstrike Fluffy_Pillow 64.2/100: 64% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(6)
2:38.411 finish P eviscerate Fluffy_Pillow 52.8/100: 53% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(6)
2:39.414 stealthed V shadowstrike Fluffy_Pillow 83.2/100: 83% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(6)
2:40.419 stealthed V shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(6)
2:41.422 finish P eviscerate Fluffy_Pillow 52.1/100: 52% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(4), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(7)
2:42.427 build G backstab Fluffy_Pillow 59.6/100: 60% energy | 0.0/5: 0% combo_points symbols_of_death, galeforce_striking, masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(7)
2:43.430 build G backstab Fluffy_Pillow 37.0/100: 37% energy | 1.0/5: 20% combo_points galeforce_striking, masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(7)
2:44.435 Waiting     1.113 sec 22.4/100: 22% energy | 3.0/5: 60% combo_points galeforce_striking, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(7)
2:45.548 build G backstab Fluffy_Pillow 36.1/100: 36% energy | 3.0/5: 60% combo_points frothing_rage, galeforce_striking, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(7)
2:46.551 Waiting     0.954 sec 13.3/100: 13% energy | 4.0/5: 80% combo_points frothing_rage, galeforce_striking, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(7)
2:47.505 default B nightblade Fluffy_Pillow 33.0/100: 33% energy | 5.0/5: 100% combo_points frothing_rage, galeforce_striking, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(7)
2:48.511 build G backstab Fluffy_Pillow 50.2/100: 50% energy | 0.0/5: 0% combo_points frothing_rage, galeforce_striking, masterful_navigation_final, elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(7)
2:49.516 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(7)
2:50.520 Waiting     1.934 sec 12.5/100: 13% energy | 3.0/5: 60% combo_points frothing_rage(2), galeforce_striking, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(7)
2:52.454 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 3.0/5: 60% combo_points frothing_rage(3), galeforce_striking, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
2:53.459 Waiting     1.334 sec 20.0/100: 20% energy | 5.0/5: 100% combo_points frothing_rage(3), galeforce_striking, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
2:54.793 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points frothing_rage(3), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge
2:55.798 build G backstab Fluffy_Pillow 50.0/100: 50% energy | 1.0/5: 20% combo_points frothing_rage(3), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
2:56.802 Waiting     0.800 sec 26.5/100: 27% energy | 2.0/5: 40% combo_points frothing_rage(3), galeforce_striking, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
2:57.602 build G backstab Fluffy_Pillow 35.7/100: 36% energy | 2.0/5: 40% combo_points frothing_rage(3), galeforce_striking, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge
2:58.606 Waiting     1.126 sec 12.1/100: 12% energy | 3.0/5: 60% combo_points frothing_rage(3), galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:59.732 cds L shadow_blades Fluffy_Pillow 25.0/100: 25% energy | 3.0/5: 60% combo_points frothing_rage(3), galeforce_striking, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:00.736 finish N nightblade Fluffy_Pillow 44.4/100: 44% energy | 4.0/5: 80% combo_points shadow_blades, frothing_rage(3), masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:01.741 stealth_cds R shadow_dance Fluffy_Pillow 54.9/100: 55% energy | 0.0/5: 0% combo_points shadow_blades, frothing_rage(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection
3:01.741 stealthed V shadowstrike Fluffy_Pillow 55.9/100: 56% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, master_of_shadows, frothing_rage(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection
3:02.746 stealthed V shadowstrike Fluffy_Pillow 43.3/100: 43% energy | 3.0/5: 60% combo_points shadow_blades, shadow_dance, master_of_shadows, frothing_rage(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:03.750 cds I symbols_of_death Fluffy_Pillow 31.7/100: 32% energy | 5.0/5: 100% combo_points shadow_blades, shadow_dance, master_of_shadows, frothing_rage(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
3:03.750 finish P eviscerate Fluffy_Pillow 71.7/100: 72% energy | 5.0/5: 100% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
3:04.755 stealthed V shadowstrike Fluffy_Pillow 94.0/100: 94% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, frothing_rage(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge
3:05.760 finish P eviscerate Fluffy_Pillow 82.3/100: 82% energy | 4.0/5: 80% combo_points shadow_blades, shadow_dance, symbols_of_death, frothing_rage(3), masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
3:06.765 cds K marked_for_death Fluffy_Pillow 90.5/100: 91% energy | 0.0/5: 0% combo_points shadow_blades, symbols_of_death, frothing_rage(3), masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
3:06.765 finish P eviscerate Fluffy_Pillow 90.5/100: 91% energy | 5.0/5: 100% combo_points shadow_blades, symbols_of_death, frothing_rage(3), masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
3:07.770 stealth_cds R shadow_dance Fluffy_Pillow 97.7/100: 98% energy | 0.0/5: 0% combo_points shadow_blades, symbols_of_death, frothing_rage(3), masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
3:07.770 stealthed V shadowstrike Fluffy_Pillow 98.7/100: 99% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
3:08.775 stealthed V shadowstrike Fluffy_Pillow 86.9/100: 87% energy | 3.0/5: 60% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
3:09.780 finish P eviscerate Fluffy_Pillow 83.0/100: 83% energy | 5.0/5: 100% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
3:10.786 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
3:11.790 stealthed V shadowstrike Fluffy_Pillow 80.1/100: 80% energy | 3.0/5: 60% combo_points shadow_blades, shadow_dance, symbols_of_death, masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
3:12.794 finish P eviscerate Fluffy_Pillow 60.1/100: 60% energy | 5.0/5: 100% combo_points shadow_blades, symbols_of_death, masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(15)
3:13.799 build G backstab Fluffy_Pillow 67.0/100: 67% energy | 0.0/5: 0% combo_points shadow_blades, masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14)
3:14.803 build G backstab Fluffy_Pillow 51.9/100: 52% energy | 3.0/5: 60% combo_points shadow_blades, masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(13)
3:15.807 finish N nightblade Fluffy_Pillow 28.7/100: 29% energy | 5.0/5: 100% combo_points shadow_blades, masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
3:16.813 build G backstab Fluffy_Pillow 45.5/100: 46% energy | 0.0/5: 0% combo_points shadow_blades, frothing_rage, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(11)
3:17.817 Waiting     0.628 sec 22.3/100: 22% energy | 2.0/5: 40% combo_points shadow_blades, frothing_rage, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(10)
3:18.445 build G backstab Fluffy_Pillow 37.7/100: 38% energy | 3.0/5: 60% combo_points shadow_blades, frothing_rage, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(9)
3:19.449 Waiting     1.806 sec 14.4/100: 14% energy | 5.0/5: 100% combo_points shadow_blades, frothing_rage, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
3:21.255 finish P eviscerate Fluffy_Pillow 35.5/100: 35% energy | 5.0/5: 100% combo_points frothing_rage, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
3:22.258 stealth_cds Q vanish Fluffy_Pillow 42.1/100: 42% energy | 0.0/5: 0% combo_points frothing_rage, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
3:22.258 stealthed V shadowstrike Fluffy_Pillow 43.1/100: 43% energy | 0.0/5: 0% combo_points vanish, master_of_shadows, frothing_rage, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
3:23.262 build G backstab Fluffy_Pillow 38.8/100: 39% energy | 3.0/5: 60% combo_points master_of_shadows, frothing_rage, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
3:24.265 Waiting     0.738 sec 23.4/100: 23% energy | 4.0/5: 80% combo_points master_of_shadows, frothing_rage, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(2)
3:25.003 finish P eviscerate Fluffy_Pillow 35.9/100: 36% energy | 4.0/5: 80% combo_points master_of_shadows, frothing_rage, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(2)
3:26.009 stealth_cds R shadow_dance Fluffy_Pillow 40.6/100: 41% energy | 0.0/5: 0% combo_points frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(2)
3:26.009 stealthed V shadowstrike Fluffy_Pillow 41.6/100: 42% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(2)
3:27.014 stealthed V shadowstrike Fluffy_Pillow 37.1/100: 37% energy | 3.0/5: 60% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:28.016 Waiting     0.300 sec 24.6/100: 25% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:28.316 finish P eviscerate Fluffy_Pillow 28.0/100: 28% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:29.322 stealthed V shadowstrike Fluffy_Pillow 57.6/100: 58% energy | 1.0/5: 20% combo_points shadow_dance, frothing_rage, galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:30.326 stealthed V shadowstrike Fluffy_Pillow 37.1/100: 37% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage, galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:31.331 default F arcane_torrent Fluffy_Pillow 16.6/100: 17% energy | 5.0/5: 100% combo_points frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:32.335 finish N nightblade Fluffy_Pillow 43.1/100: 43% energy | 5.0/5: 100% combo_points frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:33.340 build G backstab Fluffy_Pillow 67.6/100: 68% energy | 1.0/5: 20% combo_points frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection
3:34.345 cds I symbols_of_death Fluffy_Pillow 44.0/100: 44% energy | 2.0/5: 40% combo_points frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection
3:34.345 build G backstab Fluffy_Pillow 84.0/100: 84% energy | 2.0/5: 40% combo_points symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection
3:35.349 build G backstab Fluffy_Pillow 60.4/100: 60% energy | 3.0/5: 60% combo_points symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection
3:36.356 finish P eviscerate Fluffy_Pillow 36.8/100: 37% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection
3:37.359 cds K marked_for_death Fluffy_Pillow 37.3/100: 37% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:37.359 finish P eviscerate Fluffy_Pillow 37.3/100: 37% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:38.364 stealth_cds R shadow_dance Fluffy_Pillow 43.7/100: 44% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:38.364 stealthed V shadowstrike Fluffy_Pillow 44.7/100: 45% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:39.370 stealthed V shadowstrike Fluffy_Pillow 40.2/100: 40% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:40.374 Waiting     0.100 sec 27.7/100: 28% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:40.474 finish P eviscerate Fluffy_Pillow 28.8/100: 29% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:41.478 stealthed V shadowstrike Fluffy_Pillow 50.3/100: 50% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:42.483 stealthed V shadowstrike Fluffy_Pillow 37.7/100: 38% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:43.487 Waiting     1.585 sec 17.2/100: 17% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), galeforce_striking, masterful_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:45.072 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/5: 100% combo_points frothing_rage(2), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:46.077 build G backstab Fluffy_Pillow 41.7/100: 42% energy | 0.0/5: 0% combo_points frothing_rage(2), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:47.082 Waiting     0.800 sec 26.1/100: 26% energy | 2.0/5: 40% combo_points frothing_rage(2), masterful_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection
3:47.882 build G backstab Fluffy_Pillow 35.2/100: 35% energy | 2.0/5: 40% combo_points frothing_rage(2), masterful_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:48.885 Waiting     1.167 sec 11.7/100: 12% energy | 3.0/5: 60% combo_points frothing_rage(2), masterful_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:50.052 default B nightblade Fluffy_Pillow 33.0/100: 33% energy | 4.0/5: 80% combo_points frothing_rage(2), masterful_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:51.057 build G backstab Fluffy_Pillow 43.5/100: 43% energy | 0.0/5: 0% combo_points frothing_rage(2), masterful_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:52.061 Waiting     0.602 sec 20.3/100: 20% energy | 1.0/5: 20% combo_points frothing_rage(2), masterful_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:52.663 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 2.0/5: 40% combo_points frothing_rage(2), masterful_navigation(3), elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:53.666 Waiting     1.974 sec 12.2/100: 12% energy | 3.0/5: 60% combo_points frothing_rage(2), masterful_navigation(4), elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:55.640 build G backstab Fluffy_Pillow 35.7/100: 36% energy | 3.0/5: 60% combo_points frothing_rage(2), masterful_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:56.646 Waiting     1.227 sec 12.7/100: 13% energy | 4.0/5: 80% combo_points frothing_rage(2), masterful_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:57.873 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points frothing_rage(2), masterful_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:58.877 stealth_cds R shadow_dance Fluffy_Pillow 42.4/100: 42% energy | 0.0/5: 0% combo_points frothing_rage(2), masterful_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:58.877 stealthed V shadowstrike Fluffy_Pillow 43.4/100: 43% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:59.881 Waiting     0.100 sec 31.4/100: 31% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:59.981 stealthed V shadowstrike Fluffy_Pillow 32.6/100: 33% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:00.985 cds H potion Fluffy_Pillow 28.7/100: 29% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:00.985 finish N nightblade Fluffy_Pillow 28.7/100: 29% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
4:01.990 stealthed V shadowstrike Fluffy_Pillow 58.5/100: 58% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage(2), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
4:02.996 stealthed V shadowstrike Fluffy_Pillow 38.2/100: 38% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(2), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
4:04.001 Waiting     0.595 sec 18.0/100: 18% energy | 4.0/5: 80% combo_points frothing_rage(2), masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:04.596 cds I symbols_of_death Fluffy_Pillow 33.0/100: 33% energy | 5.0/5: 100% combo_points frothing_rage(2), masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:04.596 finish P eviscerate Fluffy_Pillow 73.0/100: 73% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:05.599 stealth_cds R shadow_dance Fluffy_Pillow 79.8/100: 80% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:05.599 stealthed V shadowstrike Fluffy_Pillow 80.8/100: 81% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:06.602 stealthed V shadowstrike Fluffy_Pillow 68.6/100: 69% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:07.607 finish P eviscerate Fluffy_Pillow 64.4/100: 64% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:08.612 stealthed V shadowstrike Fluffy_Pillow 86.2/100: 86% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:09.616 stealthed V shadowstrike Fluffy_Pillow 66.0/100: 66% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:10.620 finish P eviscerate Fluffy_Pillow 45.8/100: 46% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:11.625 cds K marked_for_death Fluffy_Pillow 46.6/100: 47% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:11.625 finish P eviscerate Fluffy_Pillow 46.6/100: 47% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:12.628 stealth_cds R shadow_dance Fluffy_Pillow 61.5/100: 61% energy | 1.0/5: 20% combo_points symbols_of_death, frothing_rage(2), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:12.628 stealthed V shadowstrike Fluffy_Pillow 62.5/100: 62% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:13.632 stealthed V shadowstrike Fluffy_Pillow 50.3/100: 50% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:14.635 finish P eviscerate Fluffy_Pillow 38.2/100: 38% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage(2), masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:15.640 stealthed V shadowstrike Fluffy_Pillow 60.0/100: 60% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage(2), masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:16.643 stealthed V shadowstrike Fluffy_Pillow 47.9/100: 48% energy | 3.0/5: 60% combo_points shadow_dance, masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8), battle_potion_of_agility
4:17.646 finish N nightblade Fluffy_Pillow 28.6/100: 29% energy | 5.0/5: 100% combo_points masterful_navigation, elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(8), battle_potion_of_agility
4:18.651 build G backstab Fluffy_Pillow 46.4/100: 46% energy | 0.0/5: 0% combo_points masterful_navigation, elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(8), battle_potion_of_agility
4:19.657 Waiting     0.300 sec 32.1/100: 32% energy | 2.0/5: 40% combo_points masterful_navigation, elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(8), battle_potion_of_agility
4:19.957 build G backstab Fluffy_Pillow 35.8/100: 36% energy | 2.0/5: 40% combo_points masterful_navigation, elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(8), battle_potion_of_agility
4:20.962 Waiting     1.814 sec 13.5/100: 13% energy | 3.0/5: 60% combo_points masterful_navigation, elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(8), battle_potion_of_agility
4:22.776 build G backstab Fluffy_Pillow 36.2/100: 36% energy | 3.0/5: 60% combo_points galeforce_striking, masterful_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(8), battle_potion_of_agility
4:23.780 Waiting     1.161 sec 21.7/100: 22% energy | 5.0/5: 100% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(8), battle_potion_of_agility
4:24.941 finish P eviscerate Fluffy_Pillow 36.2/100: 36% energy | 5.0/5: 100% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(8), battle_potion_of_agility
4:25.945 build G backstab Fluffy_Pillow 43.6/100: 44% energy | 0.0/5: 0% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(8), battle_potion_of_agility
4:26.948 Waiting     0.500 sec 29.0/100: 29% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(8)
4:27.448 build G backstab Fluffy_Pillow 35.2/100: 35% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(8)
4:28.453 Waiting     1.212 sec 12.6/100: 13% energy | 3.0/5: 60% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(8)
4:29.665 finish O nightblade Fluffy_Pillow 35.4/100: 35% energy | 4.0/5: 80% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(8)
4:30.670 build G backstab Fluffy_Pillow 46.7/100: 47% energy | 0.0/5: 0% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(8)
4:31.675 Waiting     0.300 sec 32.0/100: 32% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(8)
4:31.975 build G backstab Fluffy_Pillow 35.6/100: 36% energy | 2.0/5: 40% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(8)
4:32.978 Waiting     1.406 sec 12.8/100: 13% energy | 3.0/5: 60% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(8)
4:34.384 cds I symbols_of_death Fluffy_Pillow 29.8/100: 30% energy | 3.0/5: 60% combo_points frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(8)
4:34.596 build G backstab Fluffy_Pillow 72.3/100: 72% energy | 3.0/5: 60% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(8)
4:35.601 finish P eviscerate Fluffy_Pillow 57.4/100: 57% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(8)
4:36.605 stealth_cds R shadow_dance Fluffy_Pillow 64.5/100: 65% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(8)
4:36.605 stealthed V shadowstrike Fluffy_Pillow 65.5/100: 66% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(8)
4:37.611 stealthed V shadowstrike Fluffy_Pillow 53.5/100: 54% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(8)
4:38.616 finish P eviscerate Fluffy_Pillow 49.5/100: 50% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
4:39.618 stealthed V shadowstrike Fluffy_Pillow 71.5/100: 71% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
4:40.623 stealthed V shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(8)
4:41.628 finish P eviscerate Fluffy_Pillow 39.3/100: 39% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:42.633 cds K marked_for_death Fluffy_Pillow 46.1/100: 46% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:42.633 finish P eviscerate Fluffy_Pillow 46.1/100: 46% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:43.637 stealth_cds S shadow_dance Fluffy_Pillow 53.0/100: 53% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, galeforce_striking, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:43.637 stealthed V shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:44.641 stealthed V shadowstrike Fluffy_Pillow 49.8/100: 50% energy | 3.0/5: 60% combo_points shadow_dance, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(3), archive_of_the_titans(20), resounding_protection
4:45.644 finish N nightblade Fluffy_Pillow 37.2/100: 37% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection
4:46.650 stealthed V shadowstrike Fluffy_Pillow 74.6/100: 75% energy | 1.0/5: 20% combo_points shadow_dance, frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection
4:47.654 stealthed V shadowstrike Fluffy_Pillow 54.0/100: 54% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:48.657 Waiting     0.200 sec 33.5/100: 33% energy | 5.0/5: 100% combo_points frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:48.857 finish P eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/5: 100% combo_points frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:49.862 stealth_cds S shadow_dance Fluffy_Pillow 50.2/100: 50% energy | 1.0/5: 20% combo_points frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:49.862 stealthed V shadowstrike Fluffy_Pillow 51.2/100: 51% energy | 1.0/5: 20% combo_points shadow_dance, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:50.867 stealthed V shadowstrike Fluffy_Pillow 38.7/100: 39% energy | 3.0/5: 60% combo_points shadow_dance, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:51.872 Waiting     0.200 sec 26.1/100: 26% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:52.072 finish P eviscerate Fluffy_Pillow 36.4/100: 36% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, galeforce_striking, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:53.076 stealthed V shadowstrike Fluffy_Pillow 57.9/100: 58% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:54.082 stealthed V shadowstrike Fluffy_Pillow 37.5/100: 37% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:55.087 Waiting     0.900 sec 25.0/100: 25% energy | 5.0/5: 100% combo_points frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:55.987 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/5: 100% combo_points frothing_rage, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:56.991 build G backstab Fluffy_Pillow 41.9/100: 42% energy | 0.0/5: 0% combo_points frothing_rage, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:57.995 Waiting     0.969 sec 18.4/100: 18% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:58.964 build G backstab Fluffy_Pillow 37.6/100: 38% energy | 2.0/5: 40% combo_points frothing_rage, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:59.970 Waiting     0.928 sec 14.3/100: 14% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)

Stats

Level Bonus (120) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -3 1524 1464 0
Agility 1467 1 6565 6147 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 2 1681 1469 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Energy 100 100 0
Combo Points 5 5 0
Crit 22.83% 22.83% 852
Haste 13.50% 13.50% 918
Damage / Heal Versatility 0.80% 0.80% 68
Attack Power 7222 6147 0
Mastery 59.22% 59.22% 1164
Armor 1897 1897 1897
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Bloodstorm Buckle
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Mastery, +68 Vers }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Striders of the Putrescent Path
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +115 Mastery, +68 Crit }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Plasma-Spattered Greatcloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +81 Mastery, +57 Crit }
Local Main Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: galeforce_striking
Local Off Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: masterful_navigation

Talents

Level
15 Weaponmaster (Subtlety Rogue) Find Weakness (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus (Subtlety Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Soothing Darkness (Subtlety Rogue) Cheat Death Elusiveness
75 Shot in the Dark (Subtlety Rogue) Night Terrors (Subtlety Rogue) Prey on the Weak
90 Dark Shadow (Subtlety Rogue) Alacrity (Subtlety Rogue) Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Secret Technique (Subtlety Rogue) Shuriken Tornado (Subtlety Rogue)

Profile

rogue="T22_Rogue_Subtlety"
spec=subtlety
level=120
race=blood_elf
role=attack
position=back
talents=2330031

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Used to define when to use stealth CDs or builders
actions.precombat+=/variable,name=stealth_threshold,value=60+talent.vigor.enabled*35+talent.master_of_shadows.enabled*10
actions.precombat+=/stealth
actions.precombat+=/marked_for_death,precombat_seconds=15
actions.precombat+=/shadow_blades,precombat_seconds=1
actions.precombat+=/potion

# Executed every time the actor is available.
# Check CDs at first
actions=call_action_list,name=cds
# Run fully switches to the Stealthed Rotation (by doing so, it forces pooling if nothing is available).
actions+=/run_action_list,name=stealthed,if=stealthed.all
# Apply Nightblade at 2+ CP during the first 10 seconds, after that 4+ CP if it expires within the next GCD or is not up
actions+=/nightblade,if=target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
# Consider using a Stealth CD when reaching the energy threshold and having space for at least 4 CP
actions+=/call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&combo_points.deficit>=4
# Finish at 4+ without DS, 5+ with DS (outside stealth)
actions+=/call_action_list,name=finish,if=combo_points>=4+talent.deeper_stratagem.enabled|target.time_to_die<=1&combo_points>=3
# Use a builder when reaching the energy threshold (minus 40 if none of Alacrity, Shadow Focus, and Master of Shadows is selected)
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold-40*!(talent.alacrity.enabled|talent.shadow_focus.enabled|talent.master_of_shadows.enabled)
# Lowest priority in all of the APL because it causes a GCD
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen
actions+=/arcane_pulse
actions+=/lights_judgment

actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2|buff.the_dreadlords_deceit.stack>=29
actions.build+=/gloomblade
actions.build+=/backstab

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|(buff.vanish.up&(buff.shadow_blades.up|cooldown.shadow_blades.remains<=30))
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/symbols_of_death,if=dot.nightblade.ticking
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit
actions.cds+=/marked_for_death,if=raid_event.adds.in>30&!stealthed.all&combo_points.deficit>=cp_max_spend
actions.cds+=/shadow_blades,if=combo_points.deficit>=2+stealthed.all
actions.cds+=/shuriken_tornado,if=spell_targets>=3&dot.nightblade.ticking&buff.symbols_of_death.up&buff.shadow_dance.up
actions.cds+=/shadow_dance,if=!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled

# Keep up Nightblade if it is about to run out. Do not use NB during Dance, if talented into Dark Shadow.
actions.finish=nightblade,if=(!talent.dark_shadow.enabled|!buff.shadow_dance.up)&target.time_to_die-remains>6&remains<tick_time*2&(spell_targets.shuriken_storm<4|!buff.symbols_of_death.up)
# Multidotting outside Dance on targets that will live for the duration of Nightblade with refresh during pandemic if you have less than 6 targets or play with Secret Technique.
actions.finish+=/nightblade,cycle_targets=1,if=spell_targets.shuriken_storm>=2&(spell_targets.shuriken_storm<=5|talent.secret_technique.enabled)&!buff.shadow_dance.up&target.time_to_die>=(5+(2*combo_points))&refreshable
# Refresh Nightblade early if it will expire during Symbols. Do that refresh if SoD gets ready in the next 5s.
actions.finish+=/nightblade,if=remains<cooldown.symbols_of_death.remains+10&cooldown.symbols_of_death.remains<=5&target.time_to_die-remains>cooldown.symbols_of_death.remains+5
# Secret Technique during Symbols. With Dark Shadow and multiple targets also only during Shadow Dance (until threshold in next line).
actions.finish+=/secret_technique,if=buff.symbols_of_death.up&(!talent.dark_shadow.enabled|spell_targets.shuriken_storm<2|buff.shadow_dance.up)
# With enough targets always use SecTec on CD.
actions.finish+=/secret_technique,if=spell_targets.shuriken_storm>=2+talent.dark_shadow.enabled+talent.nightstalker.enabled
actions.finish+=/eviscerate

# Helper Variable
actions.stealth_cds=variable,name=shd_threshold,value=cooldown.shadow_dance.charges_fractional>=1.75
# Vanish unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
actions.stealth_cds+=/vanish,if=!variable.shd_threshold&debuff.find_weakness.remains<1
# Pool for Shadowmeld + Shadowstrike unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10&!variable.shd_threshold&debuff.find_weakness.remains<1
# With Dark Shadow only Dance when Nightblade will stay up. Use during Symbols or above threshold.
actions.stealth_cds+=/shadow_dance,if=(!talent.dark_shadow.enabled|dot.nightblade.remains>=5+talent.subterfuge.enabled)&(variable.shd_threshold|buff.symbols_of_death.remains>=1.2|spell_targets>=4&cooldown.symbols_of_death.remains>10)
actions.stealth_cds+=/shadow_dance,if=target.time_to_die<cooldown.symbols_of_death.remains

# If stealth is up, we really want to use Shadowstrike to benefits from the passive bonus, even if we are at max cp (from the precombat MfD).
actions.stealthed=shadowstrike,if=buff.stealth.up
# Finish at 4+ CP without DS, 5+ with DS, and 6 with DS after Vanish
actions.stealthed+=/call_action_list,name=finish,if=combo_points.deficit<=1-(talent.deeper_stratagem.enabled&buff.vanish.up)
# At 2 targets with Secret Technique keep up Find Weakness by cycling Shadowstrike.
actions.stealthed+=/shadowstrike,cycle_targets=1,if=talent.secret_technique.enabled&talent.find_weakness.enabled&debuff.find_weakness.remains<1&spell_targets.shuriken_storm=2&target.time_to_die-remains>6
actions.stealthed+=/shuriken_storm,if=spell_targets.shuriken_storm>=3
actions.stealthed+=/shadowstrike

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=plasmaspattered_greatcloak,id=160644,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=bloodstorm_buckle,id=160622,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=striders_of_the_putrescent_path,id=160729,bonus_id=4800/1507
finger1=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=galeforce_striking
off_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=masterful_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=852
# gear_haste_rating=918
# gear_mastery_rating=1164
# gear_versatility_rating=68
# gear_armor=1897

T22_Shaman_Enhancement : 17020 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17019.6 17019.6 19.9 / 0.117% 3393.0 / 19.9% 781.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
21.2 20.8 Mana 1.49% 56.1 100.0% 100%
Talents
  • 15: Lightning Shield (Enhancement Shaman)
  • 30: Landslide (Enhancement Shaman)
  • 60: Searing Assault (Enhancement Shaman)
  • 90: Sundering (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Shaman_Enhancement 17020
Flametongue 208 (1882) 1.2% (11.1%) 28.5 10.67sec 19832 17563 Direct 28.5 1749 3496 2194 25.5% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.46 28.46 0.00 0.00 1.1292 0.0000 62435.18 62435.18 0.00 17562.93 17562.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.21 74.53% 1748.70 1603 2579 1748.03 1638 1860 37094 37094 0.00
crit 7.25 25.47% 3495.75 3206 5158 3493.62 0 4610 25341 25341 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.
 
    Flametongue Attack 921 5.4% 692.8 0.66sec 398 0 Direct 692.8 317 634 398 25.6% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 692.85 692.85 0.00 0.00 0.0000 0.0000 276066.04 276066.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 515.46 74.40% 317.25 288 463 317.17 307 328 163530 163530 0.00
crit 177.39 25.60% 634.38 576 926 634.25 610 669 112536 112536 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.044000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Searing Assault 753 4.4% 28.5 10.67sec 7938 0 Periodic 84.3 2132 4265 2681 25.7% 0.0% 56.2%

Stats details: searing_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.46 0.00 84.28 84.28 0.0000 2.0000 225936.10 225936.10 0.00 1340.44 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.6 74.27% 2132.02 1958 3149 2131.13 2042 2219 133449 133449 0.00
crit 21.7 25.73% 4265.19 3915 6297 4263.69 3966 4777 92487 92487 0.00
 
 

Action details: searing_assault

Static Values
  • id:268429
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:268429
  • name:Searing Assault
  • school:fire
  • tooltip:Suffering {$s1=0} Fire damage every $t1 sec.
  • description:{$@spelldesc192087=Flametongue now causes the target to burn for $268429o1 Fire damage over {$268429d=6 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frenetic Blow 297 1.7% 3.6 71.98sec 24501 0 Direct 3.6 19449 38899 24502 26.0% 0.0%  

Stats details: frenetic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.0000 0.0000 89164.62 127471.54 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.69 74.02% 19449.09 19401 19935 19007.63 0 19935 52392 74901 29.37
crit 0.95 25.98% 38898.85 38801 39870 24909.27 0 39870 36772 52570 19.24
 
 

Action details: frenetic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=12846} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:25774.82
  • base_dd_max:25774.82
 
Lava Lash 1433 8.4% 54.1 5.24sec 7963 6943 Direct 54.1 6342 12682 7963 25.6% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.05 54.05 0.00 0.00 1.1469 0.0000 430448.24 430448.24 0.00 6943.16 6943.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.23 74.43% 6342.14 5873 9446 6338.40 5999 6774 255148 255148 0.00
crit 13.82 25.57% 12681.64 11745 18892 12673.33 11812 14524 175300 175300 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Lightning Shield 789 4.6% 256.9 1.69sec 919 0 Direct 255.9 735 1468 923 25.7% 0.0%  

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 256.95 255.95 0.00 0.00 0.0000 0.0000 236261.10 236261.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.16 74.30% 734.52 653 1050 734.36 684 794 139679 139679 0.00
crit 65.79 25.70% 1468.08 1305 2099 1467.77 1356 1627 96582 96582 0.00
 
 

Action details: lightning_shield

Static Values
  • id:273324
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:273324
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:{$@spelldesc192106=Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.}
 
main_hand 1578 9.3% 157.7 1.91sec 3005 1779 Direct 157.7 2818 5636 3005 25.6% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.72 157.72 0.00 0.00 1.6895 0.0000 473931.28 677541.67 30.05 1778.53 1778.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.45 55.44% 2818.18 2738 3214 2818.43 2787 2873 246440 352315 30.05
crit 40.36 25.59% 5636.41 5476 6428 5636.92 5550 5813 227492 325227 30.05
miss 29.91 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
offhand 788 4.6% 157.4 1.91sec 1503 887 Direct 157.4 1409 2818 1503 25.6% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.43 157.43 0.00 0.00 1.6934 0.0000 236561.81 338193.52 30.05 887.33 887.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.24 55.41% 1408.85 1369 1607 1408.98 1393 1436 122905 175707 30.05
crit 40.34 25.62% 2817.70 2738 3214 2817.96 2773 2900 113657 162487 30.05
miss 29.86 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Rockbiter 1048 6.2% 62.6 4.83sec 5024 4428 Direct 62.6 4001 8002 5024 25.6% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.58 62.58 0.00 0.00 1.1346 0.0000 314404.24 314404.24 0.00 4427.85 4427.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.59 74.44% 4001.08 3674 5910 3999.32 3810 4214 186392 186392 0.00
crit 16.00 25.56% 8002.00 7348 11820 7999.65 7433 9239 128012 128012 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormstrike 0 (5346) 0.0% (31.5%) 86.3 3.44sec 18597 16292

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.34 0.00 0.00 0.00 1.1415 0.0000 0.00 0.00 0.00 16292.42 16292.42
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 3564 21.0% 86.3 3.44sec 12398 0 Direct 86.3 9865 19693 12398 25.8% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.34 86.34 0.00 0.00 0.0000 0.0000 1070353.87 1530199.40 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.08 74.23% 9864.68 6189 18134 9857.57 7275 12883 632150 903734 30.05
crit 22.25 25.77% 19692.75 12378 36267 19679.95 13793 27014 438204 626465 30.05
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Stormstrike Off-Hand 1782 10.5% 86.3 3.44sec 6199 0 Direct 86.3 4930 9860 6199 25.8% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.34 86.34 0.00 0.00 0.0000 0.0000 535231.40 765177.57 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.10 74.25% 4930.01 3095 9067 4926.06 3723 6451 316021 451789 30.05
crit 22.23 25.75% 9859.79 6189 18134 9848.95 6728 13531 219211 313388 30.05
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Sundering 670 3.9% 7.4 42.10sec 27265 24084 Direct 7.4 21787 43511 27264 25.2% 0.0%  

Stats details: sundering

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.37 7.37 0.00 0.00 1.1321 0.0000 201028.66 201028.66 0.00 24083.94 24083.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.51 74.79% 21787.31 20358 32338 21784.31 20384 28291 120140 120140 0.00
crit 1.86 25.21% 43510.80 40769 63737 38355.15 0 63737 80889 80889 0.00
 
 

Action details: sundering

Static Values
  • id:197214
  • school:flamestrike
  • resource:maelstrom
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:40.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.
 
Windfury Attack 366 2.2% 134.7 4.40sec 815 0 Direct 134.7 649 1297 815 25.6% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.73 134.73 0.00 0.00 0.0000 0.0000 109788.75 156956.20 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.21 74.38% 648.71 622 729 648.88 635 667 65005 92932 30.05
crit 34.52 25.62% 1297.17 1245 1459 1297.50 1263 1352 44784 64024 30.05
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=25}% chance to trigger two extra attacks, dealing $25504sw1 Physical damage each.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Windlash 395 2.3% 21.3 9.63sec 5483 4305 Direct 21.3 4366 8731 5482 25.6% 0.0%  

Stats details: windlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.30 21.30 0.00 0.00 1.2734 0.0000 116770.66 116770.66 0.00 4305.39 4305.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.85 74.42% 4365.90 3914 4595 4365.11 3945 4538 69202 69202 0.00
crit 5.45 25.58% 8731.06 7829 9190 8711.96 0 9190 47569 47569 0.00
 
 

Action details: windlash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Windlash Off-Hand 196 1.1% 21.1 9.72sec 2743 2155 Direct 21.1 2183 4365 2743 25.6% 0.0%  

Stats details: windlash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.10 21.10 0.00 0.00 1.2728 0.0000 57866.08 57866.08 0.00 2154.84 2154.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.69 74.36% 2183.24 1957 2298 2182.77 1989 2264 34254 34254 0.00
crit 5.41 25.64% 4364.70 3914 4595 4356.69 0 4595 23612 23612 0.00
 
 

Action details: windlash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Windstrike 0 (1808) 0.0% (10.5%) 18.3 11.26sec 29174 30526

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 0.00 0.00 0.00 0.9557 0.0000 0.00 0.00 0.00 30525.66 30525.66
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 1206 7.0% 18.3 11.26sec 19467 0 Direct 18.3 15430 30943 19466 26.0% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 18.33 0.00 0.00 0.0000 0.0000 356881.85 356881.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.56 73.98% 15430.18 8848 25924 15341.99 9446 22899 209289 209289 0.00
crit 4.77 26.02% 30943.35 17696 51849 30688.62 0 51154 147593 147593 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Windstrike Off-Hand 602 3.5% 18.3 11.26sec 9707 0 Direct 18.3 7718 15455 9707 25.7% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 18.33 0.00 0.00 0.0000 0.0000 177958.17 177958.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.62 74.30% 7717.99 4424 12962 7673.86 4785 11355 105127 105127 0.00
crit 4.71 25.70% 15455.44 8848 25924 15261.30 0 25425 72831 72831 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - greater_earth_elemental 315 / 76
melee 315 0.4% 54.3 3.38sec 420 317 Direct 54.3 335 669 420 25.6% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.27 54.27 0.00 0.00 1.3243 0.0000 22804.14 32601.25 30.05 317.29 317.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.39 74.43% 334.60 320 375 334.85 327 344 13516 19323 30.05
crit 13.88 25.57% 669.30 640 750 669.87 641 714 9288 13279 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - spirit_wolf 2382 / 349
melee 2382 2.0% 81.7 6.26sec 1272 1237 Direct 81.7 1013 2025 1272 25.7% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.66 81.66 0.00 0.00 1.0283 0.0000 103902.50 148541.09 30.05 1237.27 1237.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.71 74.35% 1012.57 968 1114 1012.83 995 1063 61475 87886 30.05
crit 20.95 25.65% 2025.14 1937 2229 2025.62 1949 2133 42427 60655 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
T22_Shaman_Enhancement
Ascendance 2.0 181.93sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9947 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.strike.remains>0
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=66}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
Berserking 2.0 192.85sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Bloodlust 1.5 300.49sec

Stats details: bloodlust

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bloodlust

Static Values
  • id:2825
  • school:nature
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:4300.0
  • secondary_cost:0.0
  • cooldown:300.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.health.pct<25|time>0.500
Spelldata
  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
 
Earth Elemental 1.5 300.47sec

Stats details: earth_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: earth_elemental

Static Values
  • id:188616
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:188616
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:{$@spelldesc198103=Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}.}
 
Feral Spirit 3.0 120.46sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.0992 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Wind Shear 11.4 27.19sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ancestral Resonance 1.5 0.0 300.5sec 300.5sec 17.19% 0.00% 25.8(25.8) 1.1

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_ancestral_resonance
  • max_stacks:20
  • duration:40.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:mastery_rating
  • amount:83.00

Stack Uptimes

  • ancestral_resonance_1:0.48%
  • ancestral_resonance_2:0.48%
  • ancestral_resonance_3:0.48%
  • ancestral_resonance_4:0.47%
  • ancestral_resonance_5:0.47%
  • ancestral_resonance_6:0.47%
  • ancestral_resonance_7:0.46%
  • ancestral_resonance_8:0.46%
  • ancestral_resonance_9:0.46%
  • ancestral_resonance_10:0.46%
  • ancestral_resonance_11:0.45%
  • ancestral_resonance_12:0.45%
  • ancestral_resonance_13:0.45%
  • ancestral_resonance_14:0.45%
  • ancestral_resonance_15:0.44%
  • ancestral_resonance_16:0.44%
  • ancestral_resonance_17:0.44%
  • ancestral_resonance_18:0.44%
  • ancestral_resonance_19:0.43%
  • ancestral_resonance_20:8.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:277943
  • name:Ancestral Resonance
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc277666=When you cast $?<s2825>[Bloodlust][Heroism], your Mastery increases by {$s1=0} every second, stacking up to {$277943u=20} times.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:9.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=4}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 94.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=66}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Battle Potion of Agility 2.0 0.0 195.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 192.7sec 192.7sec 6.73% 7.33% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 76.0sec 66.1sec 9.01% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_crit_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 75.1sec 65.8sec 8.96% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_haste_1:8.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.7 0.2 74.5sec 65.1sec 9.06% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 75.2sec 66.0sec 8.94% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:240.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 1.1 27.3 83.0sec 10.7sec 99.48% 99.51% 27.3(27.3) 0.1

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • flametongue_1:99.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frothing Rage 5.0 12.2 63.9sec 17.2sec 75.56% 0.00% 0.0(0.0) 0.6

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.50%
  • frothing_rage_2:25.07%
  • frothing_rage_3:22.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Gale-Force Striking 7.1 4.3 42.1sec 25.0sec 44.35% 0.00% 4.3(4.3) 6.6

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_galeforce_striking
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • galeforce_striking_1:44.35%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267612
  • name:Gale-Force Striking
  • tooltip:Increases attack speed by $s%.
  • description:{$@spelldesc255141=Permanently enchant a weapon to sometimes increase your attack speed by $267612s% for {$267612d=15 seconds} when using melee or ranged attacks and abilities.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Landslide 9.7 2.9 30.0sec 22.8sec 37.53% 39.76% 2.9(2.9) 9.4

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • landslide_1:37.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Your next Stormstrike will deal {$s1=100}% increased damage.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] has a {$h=20}% chance to increase the damage of your next Stormstrike by {$202004s1=100}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lightning Shield 11.0 209.3 28.3sec 1.3sec 100.00% 100.00% 10.0(10.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_lightning_shield
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lightning_shield_1:10.71%
  • lightning_shield_3:9.99%
  • lightning_shield_5:10.02%
  • lightning_shield_7:10.10%
  • lightning_shield_9:10.03%
  • lightning_shield_11:9.97%
  • lightning_shield_13:9.88%
  • lightning_shield_15:9.88%
  • lightning_shield_17:9.76%
  • lightning_shield_19:9.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192106
  • name:Lightning Shield
  • tooltip:Chance to deal {$192109s1=0} Nature damage when you take melee damage.
  • description:Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Lightning Shield Overcharge 10.0 0.0 29.6sec 29.6sec 32.87% 35.43% 98.4(98.4) 9.7

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_lightning_shield_overcharge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • lightning_shield_overcharge_1:32.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273323
  • name:Lightning Shield Overcharge
  • tooltip:Melee attacks are causing an extra {$273324s1=0} Nature damage to the target. Generating {$s2=10} Maelstrom every $t2 sec.
  • description:{$@spelldesc192106=Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Natural Harmony: Fire 1.0 781.7 0.0sec 0.4sec 99.58% 0.00% 781.7(781.7) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_natural_harmony_fire
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:88.00

Stack Uptimes

  • natural_harmony_fire_1:99.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279028
  • name:Natural Harmony: Fire
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc278697=Dealing Fire damage grants {$s1=0} critical strike for {$279028d=12 seconds}. Dealing Frost damage grants {$s2=0} mastery for {$279029d=12 seconds}. Dealing Nature damage grants {$s3=0} haste for {$279033d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Natural Harmony: Nature 1.0 317.5 0.0sec 0.9sec 100.00% 0.00% 317.5(317.5) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_natural_harmony_nature
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:88.00

Stack Uptimes

  • natural_harmony_nature_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279033
  • name:Natural Harmony: Nature
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc278697=Dealing Fire damage grants {$s1=0} critical strike for {$279028d=12 seconds}. Dealing Frost damage grants {$s2=0} mastery for {$279029d=12 seconds}. Dealing Nature damage grants {$s3=0} haste for {$279033d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.9 0.0 59.3sec 37.2sec 37.98% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.49%
  • overwhelming_power_2:1.49%
  • overwhelming_power_3:1.50%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.51%
  • overwhelming_power_6:1.51%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.53%
  • overwhelming_power_10:1.53%
  • overwhelming_power_11:1.54%
  • overwhelming_power_12:1.54%
  • overwhelming_power_13:1.55%
  • overwhelming_power_14:1.55%
  • overwhelming_power_15:1.56%
  • overwhelming_power_16:1.56%
  • overwhelming_power_17:1.57%
  • overwhelming_power_18:1.57%
  • overwhelming_power_19:1.58%
  • overwhelming_power_20:1.58%
  • overwhelming_power_21:1.59%
  • overwhelming_power_22:1.59%
  • overwhelming_power_23:1.61%
  • overwhelming_power_24:1.63%
  • overwhelming_power_25:0.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.1sec 10.4sec 68.89% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.02%
  • quick_navigation_2:17.53%
  • quick_navigation_3:16.88%
  • quick_navigation_4:16.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.2sec 52.2sec 18.08% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 46.2 3.8 6.4sec 5.9sec 16.00% 43.75% 5.4(5.5) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stormbringer_1:16.00%

Trigger Attempt Success

  • trigger_pct:96.73%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown, deals {$s4=25}% increased damage, and its cost is reduced by {$s3=100}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to deal {$201846s4=25}% increased damage, cost {$201846s3=100}% less Maelstrom, and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Titanic Overcharge 12.3 33.2 25.1sec 6.6sec 85.33% 0.00% 3.7(3.7) 11.4

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:38.83

Stack Uptimes

  • titanic_overcharge_1:23.00%
  • titanic_overcharge_2:16.86%
  • titanic_overcharge_3:12.31%
  • titanic_overcharge_4:9.00%
  • titanic_overcharge_5:6.56%
  • titanic_overcharge_6:4.78%
  • titanic_overcharge_7:3.44%
  • titanic_overcharge_8:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=34} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 25.4 26.3 12.0sec 5.9sec 65.65% 0.00% 1.7(1.7) 24.7

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.21%
  • unstable_flames_2:16.53%
  • unstable_flames_3:8.34%
  • unstable_flames_4:4.24%
  • unstable_flames_5:4.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Flametongue: Windfury Attack 134.1 4.4sec
Lightning Shield Overcharge: Windfury Attack 49.4 11.1sec
Maelstrom Weapon: Windfury Attack 134.7 4.4sec
Stormbringer: Windfury Attack 8.9 31.1sec
Flametongue: main_hand 127.0 2.4sec
Lightning Shield Overcharge: main_hand 41.5 6.6sec
Maelstrom Weapon: main_hand 127.8 2.4sec
Stormbringer: main_hand 8.3 31.5sec
Windfury: main_hand 33.9 8.6sec
Flametongue: Windlash 21.1 9.7sec
Lightning Shield Overcharge: Windlash 7.6 25.2sec
Maelstrom Weapon: Windlash 21.3 9.6sec
Stormbringer: Windlash 1.5 76.0sec
Windfury: Windlash 5.7 36.8sec
Flametongue: offhand 126.8 2.3sec
Lightning Shield Overcharge: offhand 41.5 6.6sec
Maelstrom Weapon: offhand 127.6 2.3sec
Stormbringer: offhand 8.3 31.3sec
Flametongue: Windlash Off-Hand 20.9 9.8sec
Lightning Shield Overcharge: Windlash Off-Hand 7.6 25.1sec
Maelstrom Weapon: Windlash Off-Hand 21.1 9.7sec
Stormbringer: Windlash Off-Hand 1.5 73.8sec
Stormbringer: Rockbiter 4.1 55.5sec
Lightning Shield Overcharge: Windstrike 7.7 25.9sec
Flametongue: Windstrike 18.1 11.4sec
Stormbringer: Windstrike 1.3 71.4sec
Windfury: Windstrike 4.9 41.6sec
Flametongue: Windstrike Off-Hand 18.1 11.4sec
Lightning Shield Overcharge: Windstrike Off-Hand 7.7 25.9sec
Stormbringer: Windstrike Off-Hand 1.2 72.1sec
Stormbringer: Flametongue 1.9 81.7sec
Lightning Shield Overcharge: Sundering 2.3 82.5sec
Lightning Shield Overcharge: Stormstrike 35.7 7.7sec
Flametongue: Stormstrike 86.3 3.4sec
Stormbringer: Stormstrike 5.7 41.2sec
Windfury: Stormstrike 22.9 12.4sec
Flametongue: Stormstrike Off-Hand 86.3 3.4sec
Lightning Shield Overcharge: Stormstrike Off-Hand 35.7 7.7sec
Stormbringer: Stormstrike Off-Hand 5.6 41.3sec
Flametongue: Lava Lash 54.1 5.2sec
Lightning Shield Overcharge: Lava Lash 19.2 14.1sec
Stormbringer: Lava Lash 3.5 58.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Wind Shear15.3730.00136.830158.272115.925220.663
Rockbiter1.2560.0018.04721.4340.78468.996
Windstrike1.1540.0013.70815.2972.83031.931
Flametongue1.8160.00120.54345.83915.53084.517
Bloodlust0.6120.0013.3250.2300.0003.325
Feral Spirit0.5820.0013.3450.9010.0005.125
Ascendance2.1900.00134.5001.9120.00034.500
Sundering2.3820.00141.63113.3210.35854.564
Stormstrike1.3670.0017.422113.63145.746198.635

Resources

Resource Usage Type Count Total Average RPE APR
T22_Shaman_Enhancement
bloodlust Mana 1.5 6357.4 4300.0 4299.6 0.0
lava_lash Maelstrom 54.1 2162.2 40.0 40.0 199.1
stormstrike Maelstrom 86.3 1396.6 16.2 16.2 1149.7
sundering Maelstrom 7.4 147.5 20.0 20.0 1363.2
windstrike Maelstrom 18.3 123.2 6.7 6.7 4342.9
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 134.74 505.12 (12.97%) 3.75 168.56 25.02%
Main Hand Maelstrom 127.81 543.64 (13.96%) 4.25 95.40 14.93%
Windlash Maelstrom 21.30 47.20 (1.21%) 2.22 59.29 55.68%
Off-Hand Maelstrom 127.58 536.48 (13.78%) 4.21 101.41 15.90%
Windlash Off-Hand Maelstrom 21.10 44.83 (1.15%) 2.12 60.67 57.51%
Rockbiter Maelstrom 62.58 1269.73 (32.61%) 20.29 294.83 18.84%
Feral Spirit Maelstrom 81.66 255.71 (6.57%) 3.13 152.61 37.37%
mana_regen Mana 270.17 6243.61 (100.00%) 23.11 185026.90 96.74%
Lightning Shield Overcharge Maelstrom 98.39 690.92 (17.74%) 7.02 292.97 29.78%
Resource RPS-Gain RPS-Loss
Mana 20.81 21.19
Maelstrom 12.98 12.76
Combat End Resource Mean Min Max
Mana 19893.30 15714.72 20000.00
Maelstrom 64.35 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 43.0%

Statistics & Data Analysis

Fight Length
Sample Data T22_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Shaman_Enhancement Damage Per Second
Count 7499
Mean 17019.63
Minimum 14397.66
Maximum 20491.23
Spread ( max - min ) 6093.56
Range [ ( max - min ) / 2 * 100% ] 17.90%
Standard Deviation 878.8964
5th Percentile 15636.37
95th Percentile 18544.11
( 95th Percentile - 5th Percentile ) 2907.75
Mean Distribution
Standard Deviation 10.1493
95.00% Confidence Intervall ( 16999.74 - 17039.52 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 103
0.1% Error 10245
0.1 Scale Factor Error with Delta=300 6595
0.05 Scale Factor Error with Delta=300 26377
0.01 Scale Factor Error with Delta=300 659416
Priority Target DPS
Sample Data T22_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 17019.63
Minimum 14397.66
Maximum 20491.23
Spread ( max - min ) 6093.56
Range [ ( max - min ) / 2 * 100% ] 17.90%
Standard Deviation 878.8964
5th Percentile 15636.37
95th Percentile 18544.11
( 95th Percentile - 5th Percentile ) 2907.75
Mean Distribution
Standard Deviation 10.1493
95.00% Confidence Intervall ( 16999.74 - 17039.52 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 103
0.1% Error 10245
0.1 Scale Factor Error with Delta=300 6595
0.05 Scale Factor Error with Delta=300 26377
0.01 Scale Factor Error with Delta=300 659416
DPS(e)
Sample Data T22_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 17019.63
Minimum 14397.66
Maximum 20491.23
Spread ( max - min ) 6093.56
Range [ ( max - min ) / 2 * 100% ] 17.90%
Damage
Sample Data T22_Shaman_Enhancement Damage
Count 7499
Mean 4971088.07
Minimum 3469912.44
Maximum 6690875.28
Spread ( max - min ) 3220962.84
Range [ ( max - min ) / 2 * 100% ] 32.40%
DTPS
Sample Data T22_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
6 11.44 wind_shear
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck35,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>35))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool80,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>80)))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>70)))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>60)))
7 1.00 auto_attack
0.00 use_items
8 0.00 call_action_list,name=opener
9 0.00 call_action_list,name=asc,if=buff.ascendance.up
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=cds
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.asc
# count action,conditions
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
E 5.35 rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
F 18.33 windstrike
actions.buffs
# count action,conditions
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
G 24.12 rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
0.00 fury_of_air,if=!ticking&maelstrom>=20
H 1.11 flametongue,if=!buff.flametongue.up
0.00 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck25
I 2.68 flametongue,if=buff.flametongue.remains<4.8+gcd
0.00 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8+gcd&variable.furyCheck25
0.00 totem_mastery,if=buff.resonance_totem.remains<2
actions.cds
# count action,conditions
J 1.48 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
K 2.00 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
L 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
M 2.97 feral_spirit
N 2.00 ascendance,if=cooldown.strike.remains>0
O 1.47 earth_elemental
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 sundering,if=active_enemies>=3
0.00 stormstrike,cycle_targets=1,if=azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
P 39.77 stormstrike,if=buff.stormbringer.up|(buff.gathering_storms.up&variable.OCPool70&variable.furyCheck35)
0.00 crash_lightning,if=active_enemies>=3&variable.furyCheck25
0.00 lightning_bolt,if=talent.overcharge.enabled&active_enemies=1&variable.furyCheck45&maelstrom>=40
Q 46.57 stormstrike,if=variable.OCPool70&variable.furyCheck35
R 7.37 sundering
0.00 crash_lightning,if=talent.forceful_winds.enabled&active_enemies>1&variable.furyCheck25
S 24.67 flametongue,if=talent.searing_assault.enabled
0.00 lava_lash,if=buff.hot_hand.react
0.00 crash_lightning,if=active_enemies>1&variable.furyCheck25
actions.filler
# count action,conditions
T 32.11 rockbiter,if=maelstrom<70
0.00 crash_lightning,if=talent.crashing_storm.enabled&variable.OCPool60
U 54.05 lava_lash,if=variable.OCPool80&variable.furyCheck45
0.00 rockbiter
0.00 flametongue
actions.opener
# count action,conditions
V 1.00 rockbiter,if=maelstrom<15&time<gcd

Sample Sequence

012457VH6JMGKOPQPQGNFEFRFFIFUFFFUEFFGQPQPIQUPQPQGSPPGQP6GPPQPGPQSURTUQGPPQSGUTUQTUPPQPGI6PQUGUTUQSTUTRQUPPSGQTUTUSPQPP6PGQPGQSMUTPPPGPQGRSUPGPQGUSUTQTU6TSQPQTUUTSQTUUUTQPPQRIUGUQTTN6FKLSFFFEFUFEFFFPGI6QGPQUTUPQGRSUUQPQ6TUSGUQTPQTSUTMQUTU6SUQPQGPQSRUTU6QTUSTUQTUPPSQTTUUTPQ6STUUTPQS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 1 food T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 2 augmentation T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
Pre precombat 5 lightning_shield Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
0:00.000 default 7 auto_attack Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom archive_of_the_titans, battle_potion_of_agility
0:00.000 opener V rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom frothing_rage, quick_navigation, archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:01.248 buffs H flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom bloodlust, natural_harmony_nature, stormbringer, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:02.199 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:02.199 cds J bloodlust Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:02.199 cds M feral_spirit Fluffy_Pillow 16308.6/20000: 82% mana | 50.0/100: 50% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance, flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:03.149 buffs G rockbiter Fluffy_Pillow 16308.6/20000: 82% mana | 65.0/100: 65% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance, flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:04.099 cds K berserking Fluffy_Pillow 16308.6/20000: 82% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(2), flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:04.099 cds O earth_elemental Fluffy_Pillow 17524.6/20000: 88% mana | 100.0/100: 100% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(2), flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:04.099 core P stormstrike Fluffy_Pillow 17524.6/20000: 88% mana | 100.0/100: 100% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(2), flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:04.926 core Q stormstrike Fluffy_Pillow 17524.6/20000: 88% mana | 100.0/100: 100% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(3), flametongue, frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans, titanic_overcharge, battle_potion_of_agility
0:05.754 core P stormstrike Fluffy_Pillow 18072.5/20000: 90% mana | 100.0/100: 100% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(4), flametongue, stormbringer, frothing_rage, quick_navigation(2), unstable_flames(2), archive_of_the_titans(2), titanic_overcharge, battle_potion_of_agility
0:06.577 core Q stormstrike Fluffy_Pillow 18583.8/20000: 93% mana | 100.0/100: 100% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(5), flametongue, frothing_rage, quick_navigation(2), unstable_flames(2), archive_of_the_titans(2), titanic_overcharge, battle_potion_of_agility
0:07.400 buffs G rockbiter Fluffy_Pillow 19540.0/20000: 98% mana | 90.0/100: 90% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(6), flametongue, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(2), titanic_overcharge, battle_potion_of_agility
0:08.223 cds N ascendance Fluffy_Pillow 19540.0/20000: 98% mana | 100.0/100: 100% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(7), flametongue, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(2), titanic_overcharge, battle_potion_of_agility
0:09.043 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(7), flametongue, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(2), titanic_overcharge, battle_potion_of_agility
0:09.867 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(8), flametongue, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(2), titanic_overcharge, battle_potion_of_agility
0:10.688 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(9), flametongue, landslide, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(3), battle_potion_of_agility
0:11.514 core R sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(10), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(3), battle_potion_of_agility
0:12.335 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(11), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_agility
0:13.179 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(11), flametongue, landslide, frothing_rage(2), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_agility
0:14.000 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(12), flametongue, landslide, frothing_rage(2), quick_navigation(3), archive_of_the_titans(3), titanic_overcharge, battle_potion_of_agility
0:14.816 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(13), flametongue, landslide, frothing_rage(2), quick_navigation(3), archive_of_the_titans(3), titanic_overcharge(2), battle_potion_of_agility
0:15.876 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(14), flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(4), titanic_overcharge(2), battle_potion_of_agility
0:16.805 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(15), flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(4), titanic_overcharge(2), battle_potion_of_agility
0:17.760 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 79.8/100: 80% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(16), lightning_shield, lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(4), titanic_overcharge(2), battle_potion_of_agility
0:18.689 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 94.8/100: 95% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(17), lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(4), titanic_overcharge(2), battle_potion_of_agility
0:19.618 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(18), lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(4), titanic_overcharge(2), battle_potion_of_agility
0:20.550 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(19), lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(4), archive_of_the_titans(5), titanic_overcharge(2), battle_potion_of_agility
0:21.478 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(4), archive_of_the_titans(5), titanic_overcharge(2), battle_potion_of_agility
0:22.407 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(7), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(4), archive_of_the_titans(5), titanic_overcharge(2), battle_potion_of_agility
0:23.336 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(9), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(5), titanic_overcharge(2)
0:24.265 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(9), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(5), titanic_overcharge(3)
0:25.191 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(11), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(6), titanic_overcharge(4)
0:26.112 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(13), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(6), titanic_overcharge(4)
0:27.035 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(15), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(6), titanic_overcharge(4)
0:27.956 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, unstable_flames, archive_of_the_titans(6), titanic_overcharge(4)
0:28.837 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(6), titanic_overcharge(4)
0:29.719 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(6), titanic_overcharge(5)
0:30.595 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(19), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation_final, archive_of_the_titans(7), titanic_overcharge(6)
0:31.467 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(7), titanic_overcharge(6)
0:32.340 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation_final, archive_of_the_titans(7), titanic_overcharge(6)
0:33.212 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(7), titanic_overcharge(6)
0:34.084 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation_final, archive_of_the_titans(7), titanic_overcharge(6)
0:34.956 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, quick_navigation_final, unstable_flames, archive_of_the_titans(7), titanic_overcharge(6)
0:35.829 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(7), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation_final, unstable_flames, archive_of_the_titans(8), titanic_overcharge(6)
0:36.702 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(9), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(25), unstable_flames, archive_of_the_titans(8), titanic_overcharge(6)
0:37.518 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, overwhelming_power(24), unstable_flames, archive_of_the_titans(8), titanic_overcharge(6)
0:38.390 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, overwhelming_power(23), unstable_flames, archive_of_the_titans(8), titanic_overcharge(6)
0:39.263 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(13), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(22), unstable_flames, archive_of_the_titans(8), titanic_overcharge(6)
0:40.140 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(15), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(21), archive_of_the_titans(9)
0:40.140 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(15), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(21), archive_of_the_titans(9)
0:41.044 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, ancestral_resonance(20), lightning_shield(15), flametongue, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(20), archive_of_the_titans(9)
0:42.219 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(19), archive_of_the_titans(9)
0:43.398 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), galeforce_striking, overwhelming_power(18), archive_of_the_titans(9)
0:44.581 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(16), archive_of_the_titans(9), titanic_overcharge
0:45.765 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(15), unstable_flames, archive_of_the_titans(10), titanic_overcharge
0:46.952 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, overwhelming_power(14), unstable_flames, archive_of_the_titans(10), titanic_overcharge
0:48.144 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), galeforce_striking, overwhelming_power(12), unstable_flames, archive_of_the_titans(10), titanic_overcharge
0:49.343 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), galeforce_striking, overwhelming_power(11), unstable_flames(2), archive_of_the_titans(10), titanic_overcharge
0:50.546 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), galeforce_striking, overwhelming_power(10), unstable_flames(2), archive_of_the_titans(11), elemental_whirl_haste, titanic_overcharge
0:51.718 core R sundering Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), galeforce_striking, overwhelming_power(9), unstable_flames(2), archive_of_the_titans(11), elemental_whirl_haste, titanic_overcharge
0:52.893 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), overwhelming_power(8), unstable_flames(2), archive_of_the_titans(11), elemental_whirl_haste, titanic_overcharge
0:54.072 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(3), overwhelming_power(6), archive_of_the_titans(11), elemental_whirl_haste, titanic_overcharge
0:55.256 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(3), overwhelming_power(5), archive_of_the_titans(12), elemental_whirl_haste
0:56.451 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, frothing_rage(3), overwhelming_power(4), archive_of_the_titans(12), elemental_whirl_haste
0:57.648 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, frothing_rage(3), overwhelming_power(3), archive_of_the_titans(12), elemental_whirl_haste
0:58.848 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, stormbringer, frothing_rage(3), quick_navigation, overwhelming_power(2), archive_of_the_titans(12), elemental_whirl_haste
1:00.047 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation, unstable_flames, archive_of_the_titans(13), elemental_whirl_haste
1:01.253 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(13), titanic_overcharge(2)
1:02.482 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(13), titanic_overcharge(2)
1:03.711 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(13), titanic_overcharge(2)
1:04.939 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), quick_navigation, unstable_flames(2), archive_of_the_titans(13), titanic_overcharge(3)
1:06.163 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), quick_navigation, archive_of_the_titans(14), titanic_overcharge(3)
1:07.388 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), galeforce_striking, quick_navigation(2), archive_of_the_titans(14), titanic_overcharge(4)
1:08.600 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(3), galeforce_striking, quick_navigation(2), archive_of_the_titans(14), titanic_overcharge(4)
1:09.810 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, galeforce_striking, quick_navigation(2), archive_of_the_titans(14), titanic_overcharge(5)
1:11.016 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, stormbringer, galeforce_striking, quick_navigation(2), unstable_flames, archive_of_the_titans(15), titanic_overcharge(5)
1:12.221 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, stormbringer, galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(15), titanic_overcharge(5)
1:13.418 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, galeforce_striking, quick_navigation(3), unstable_flames, archive_of_the_titans(15), titanic_overcharge(5)
1:14.615 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, galeforce_striking, quick_navigation(3), unstable_flames(2), archive_of_the_titans(15), titanic_overcharge(5)
1:15.814 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, galeforce_striking, quick_navigation(3), unstable_flames(2), archive_of_the_titans(16), titanic_overcharge(5)
1:17.012 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, galeforce_striking, quick_navigation(3), unstable_flames(2), archive_of_the_titans(16), titanic_overcharge(5)
1:18.210 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, galeforce_striking, quick_navigation(3), unstable_flames(2), archive_of_the_titans(16), titanic_overcharge(5)
1:18.210 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, galeforce_striking, quick_navigation(4), unstable_flames(3), archive_of_the_titans(16), titanic_overcharge(5)
1:19.400 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, galeforce_striking, quick_navigation(4), unstable_flames(3), archive_of_the_titans(16)
1:20.620 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, galeforce_striking, quick_navigation_final, unstable_flames(3), archive_of_the_titans(17), titanic_overcharge
1:21.778 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, galeforce_striking, quick_navigation_final, unstable_flames(3), archive_of_the_titans(17), titanic_overcharge
1:22.935 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, unstable_flames(3), archive_of_the_titans(17), titanic_overcharge
1:24.093 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, unstable_flames(4), archive_of_the_titans(17), titanic_overcharge
1:25.250 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, unstable_flames(4), archive_of_the_titans(18), titanic_overcharge
1:26.407 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, unstable_flames(4), archive_of_the_titans(18), titanic_overcharge
1:27.563 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, galeforce_striking, quick_navigation_final, unstable_flames(4), archive_of_the_titans(18), titanic_overcharge
1:28.721 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, galeforce_striking, quick_navigation_final, archive_of_the_titans(18), titanic_overcharge
1:29.879 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage, galeforce_striking, quick_navigation_final, archive_of_the_titans(18)
1:31.043 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage, galeforce_striking, archive_of_the_titans(19)
1:32.296 core R sundering Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation, archive_of_the_titans(19)
1:33.536 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(19), titanic_overcharge
1:34.772 Waiting     0.600 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(19), elemental_whirl_versatility, titanic_overcharge
1:35.372 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
1:36.607 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames(2), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
1:37.842 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
1:39.070 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(24), unstable_flames(2), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
1:40.216 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(23), unstable_flames(2), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
1:41.365 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(22), unstable_flames(3), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
1:42.518 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(21), unstable_flames(3), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
1:43.672 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(20), unstable_flames(3), archive_of_the_titans(20)
1:44.834 Waiting     0.300 sec 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(19), unstable_flames(3), archive_of_the_titans(20)
1:45.134 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(18), unstable_flames(3), archive_of_the_titans(20)
1:46.501 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
1:47.674 Waiting     0.400 sec 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20), titanic_overcharge
1:48.074 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(3), overwhelming_power(15), unstable_flames, archive_of_the_titans(20), titanic_overcharge
1:49.479 Waiting     0.100 sec 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(3), overwhelming_power(14), unstable_flames, archive_of_the_titans(20), titanic_overcharge
1:49.579 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation(3), overwhelming_power(14), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
1:50.746 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(3), overwhelming_power(13), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
1:51.915 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation(4), overwhelming_power(12), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
1:53.082 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20), titanic_overcharge(2)
1:54.254 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20), titanic_overcharge(2)
1:54.254 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20), titanic_overcharge(2)
1:55.379 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20), titanic_overcharge(2)
1:56.507 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20), titanic_overcharge(2)
1:57.637 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(6), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
1:58.771 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(5), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
1:59.906 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(4), unstable_flames, archive_of_the_titans(20)
2:01.057 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(2), unstable_flames(2), archive_of_the_titans(20)
2:02.214 cds M feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), quick_navigation_final, overwhelming_power, unstable_flames(2), archive_of_the_titans(20), titanic_overcharge
2:03.368 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), titanic_overcharge
2:04.526 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge
2:05.767 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, stormbringer, frothing_rage(2), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge(2)
2:07.005 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, stormbringer, frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge(2)
2:08.242 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, stormbringer, frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge(2)
2:09.480 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(3), archive_of_the_titans(20), titanic_overcharge(2)
2:10.716 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(3), archive_of_the_titans(20), titanic_overcharge(3)
2:11.947 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage(3), archive_of_the_titans(20), titanic_overcharge(3)
2:13.177 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(3), archive_of_the_titans(20), titanic_overcharge(3)
2:14.409 core R sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(3), archive_of_the_titans(20), titanic_overcharge(4)
2:15.632 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(3), archive_of_the_titans(20), titanic_overcharge(4)
2:16.857 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(3), unstable_flames, archive_of_the_titans(20), titanic_overcharge(4)
2:18.083 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(3), unstable_flames(2), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:19.267 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(3), unstable_flames(2), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:20.453 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, stormbringer, frothing_rage(3), unstable_flames(2), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:21.639 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:22.824 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:24.009 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, unstable_flames(3), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:25.195 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation, unstable_flames(3), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:26.374 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(2), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge(5)
2:27.545 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(2), unstable_flames, archive_of_the_titans(20), elemental_whirl_haste
2:28.743 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(2), unstable_flames, archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge
2:29.936 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge
2:31.128 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge
2:32.319 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge
2:32.319 Waiting     1.000 sec 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), elemental_whirl_haste, titanic_overcharge
2:33.319 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge
2:34.703 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge
2:35.960 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
2:37.181 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, stormbringer, quick_navigation(2), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
2:38.403 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, quick_navigation(2), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
2:39.624 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, quick_navigation(2), unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
2:40.846 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, galeforce_striking, quick_navigation(2), archive_of_the_titans(20), titanic_overcharge(2)
2:42.067 Waiting     0.300 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, galeforce_striking, quick_navigation(2), archive_of_the_titans(20), titanic_overcharge(2)
2:42.367 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, galeforce_striking, quick_navigation(2), archive_of_the_titans(20), titanic_overcharge(2)
2:43.588 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, galeforce_striking, quick_navigation(3), archive_of_the_titans(20), titanic_overcharge(2)
2:44.802 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, galeforce_striking, quick_navigation(3), archive_of_the_titans(20), titanic_overcharge(2)
2:46.017 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, galeforce_striking, quick_navigation(3), archive_of_the_titans(20)
2:47.244 Waiting     0.600 sec 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, galeforce_striking, quick_navigation(4), unstable_flames, archive_of_the_titans(20)
2:47.844 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, galeforce_striking, quick_navigation_final, unstable_flames, archive_of_the_titans(20)
2:49.222 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, galeforce_striking, quick_navigation_final, unstable_flames, archive_of_the_titans(20)
2:50.385 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, galeforce_striking, quick_navigation_final, unstable_flames, archive_of_the_titans(20)
2:51.548 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, galeforce_striking, quick_navigation_final, unstable_flames, archive_of_the_titans(20), titanic_overcharge
2:52.704 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), titanic_overcharge
2:53.862 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
2:55.019 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, stormbringer, galeforce_striking, quick_navigation_final, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
2:56.177 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, stormbringer, quick_navigation_final, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
2:57.336 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, quick_navigation_final, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
2:58.495 core R sundering Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
2:59.737 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, archive_of_the_titans(20), elemental_whirl_versatility, elemental_whirl_haste, titanic_overcharge(2)
3:00.938 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, archive_of_the_titans(20), elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, titanic_overcharge(2)
3:02.139 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, archive_of_the_titans(20), elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, titanic_overcharge(2)
3:03.339 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, unstable_flames, archive_of_the_titans(20), elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, titanic_overcharge(2)
3:04.539 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, unstable_flames, archive_of_the_titans(20), elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, titanic_overcharge(2)
3:05.742 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, elemental_whirl_haste, titanic_overcharge(3)
3:06.939 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, elemental_whirl_haste, titanic_overcharge(3)
3:08.134 cds N ascendance Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, archive_of_the_titans(20), elemental_whirl_mastery, elemental_whirl_haste, titanic_overcharge(3)
3:09.421 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(3)
3:09.421 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(3)
3:10.643 cds K berserking Fluffy_Pillow 20000.0/20000: 100% mana | 64.8/100: 65% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, quick_navigation, archive_of_the_titans(20), titanic_overcharge(3)
3:10.643 cds L potion Fluffy_Pillow 20000.0/20000: 100% mana | 64.8/100: 65% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, quick_navigation, archive_of_the_titans(20), titanic_overcharge(3)
3:10.643 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 64.8/100: 65% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, quick_navigation, archive_of_the_titans(20), titanic_overcharge(3), battle_potion_of_agility
3:11.707 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 69.8/100: 70% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, quick_navigation, unstable_flames, archive_of_the_titans(20), titanic_overcharge(3), battle_potion_of_agility
3:12.807 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 64.6/100: 65% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(3), battle_potion_of_agility
3:13.870 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 69.6/100: 70% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(3), battle_potion_of_agility
3:14.935 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 64.4/100: 64% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, battle_potion_of_agility
3:16.015 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 94.4/100: 94% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, battle_potion_of_agility
3:17.132 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), archive_of_the_titans(20), elemental_whirl_mastery, battle_potion_of_agility
3:18.206 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), archive_of_the_titans(20), elemental_whirl_mastery, battle_potion_of_agility
3:19.307 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 79.8/100: 80% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), archive_of_the_titans(20), elemental_whirl_mastery, battle_potion_of_agility
3:20.380 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), archive_of_the_titans(20), elemental_whirl_mastery, battle_potion_of_agility
3:21.487 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(2), archive_of_the_titans(20), elemental_whirl_mastery, battle_potion_of_agility
3:22.719 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(20), battle_potion_of_agility
3:23.951 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(3), overwhelming_power(24), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge, battle_potion_of_agility
3:25.089 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), overwhelming_power(22), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge, battle_potion_of_agility
3:26.234 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), overwhelming_power(21), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge, battle_potion_of_agility
3:27.384 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), overwhelming_power(20), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge, battle_potion_of_agility
3:27.384 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), overwhelming_power(20), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge, battle_potion_of_agility
3:28.535 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(3), overwhelming_power(19), unstable_flames(3), archive_of_the_titans(20), titanic_overcharge, battle_potion_of_agility
3:29.689 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, stormbringer, frothing_rage, galeforce_striking, quick_navigation(3), overwhelming_power(18), unstable_flames(4), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge, battle_potion_of_agility
3:30.847 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, galeforce_striking, quick_navigation(4), overwhelming_power(17), unstable_flames(4), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(2), battle_potion_of_agility
3:31.997 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, galeforce_striking, quick_navigation(4), overwhelming_power(15), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(3), battle_potion_of_agility
3:33.150 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, galeforce_striking, quick_navigation_final, overwhelming_power(13), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(3), battle_potion_of_agility
3:34.258 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, galeforce_striking, quick_navigation_final, overwhelming_power(12), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(3), battle_potion_of_agility
3:35.369 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, stormbringer, frothing_rage, galeforce_striking, quick_navigation_final, overwhelming_power(11), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(3), battle_potion_of_agility
3:36.484 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, galeforce_striking, quick_navigation_final, overwhelming_power(10), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(3)
3:37.600 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, galeforce_striking, quick_navigation_final, overwhelming_power(9), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(3)
3:38.721 core R sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage, galeforce_striking, quick_navigation_final, overwhelming_power(8), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_crit, titanic_overcharge(4)
3:39.840 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage, galeforce_striking, quick_navigation_final, overwhelming_power(7), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
3:40.962 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(6), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
3:42.087 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation_final, overwhelming_power(4), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
3:43.217 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), galeforce_striking, overwhelming_power(3), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
3:44.477 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(3), overwhelming_power(2), unstable_flames(5), archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
3:45.694 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), overwhelming_power, unstable_flames(5), archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(5)
3:46.908 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, quick_navigation, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(5)
3:46.908 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, quick_navigation, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(5)
3:48.118 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(5)
3:49.329 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation, archive_of_the_titans(20), titanic_overcharge(5)
3:50.539 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation, archive_of_the_titans(20), titanic_overcharge(5)
3:51.753 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation, archive_of_the_titans(20), titanic_overcharge(6)
3:52.962 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation, archive_of_the_titans(20), titanic_overcharge(6)
3:54.169 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage, quick_navigation, archive_of_the_titans(20), titanic_overcharge(6)
3:55.375 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), titanic_overcharge(7)
3:56.576 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), titanic_overcharge(7)
3:57.775 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), titanic_overcharge(8)
3:58.970 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(20), titanic_overcharge(8)
4:00.159 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(2), unstable_flames, archive_of_the_titans(20), titanic_overcharge(8)
4:01.346 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(2), archive_of_the_titans(20), titanic_overcharge(8)
4:02.534 cds M feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(2), archive_of_the_titans(20), titanic_overcharge(8)
4:03.724 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(3), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge(8)
4:04.907 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(3), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge(8)
4:06.088 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(3), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge(8)
4:07.271 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(3), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge(8)
4:08.451 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), elemental_whirl_versatility
4:08.451 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), elemental_whirl_versatility
4:09.682 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
4:10.901 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
4:12.133 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, stormbringer, frothing_rage, quick_navigation(4), unstable_flames, archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
4:13.345 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(4), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
4:14.558 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(4), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
4:15.770 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), archive_of_the_titans(20), elemental_whirl_versatility, titanic_overcharge
4:16.982 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), archive_of_the_titans(20), elemental_whirl_versatility, elemental_whirl_mastery, titanic_overcharge
4:18.193 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(2)
4:19.399 core R sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(2)
4:20.605 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(2)
4:21.811 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(3)
4:23.013 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(3)
4:24.161 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
4:24.161 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
4:25.304 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(4)
4:26.448 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), titanic_overcharge(4)
4:27.591 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), titanic_overcharge(4)
4:28.733 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), titanic_overcharge(4)
4:29.875 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), titanic_overcharge(4)
4:31.018 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, quick_navigation_final, unstable_flames, archive_of_the_titans(20), titanic_overcharge(4)
4:32.161 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, unstable_flames, archive_of_the_titans(20), titanic_overcharge(4)
4:33.386 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, unstable_flames, archive_of_the_titans(20)
4:34.633 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, archive_of_the_titans(20)
4:35.881 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, stormbringer, archive_of_the_titans(20)
4:37.128 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, archive_of_the_titans(20), elemental_whirl_mastery
4:38.376 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge
4:39.617 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge
4:40.858 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge
4:42.093 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge
4:43.325 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(2)
4:44.552 Waiting     0.900 sec 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, quick_navigation, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(2)
4:45.452 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, quick_navigation, archive_of_the_titans(20), elemental_whirl_mastery, titanic_overcharge(2)
4:46.889 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, stormbringer, frothing_rage, galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
4:48.118 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation, unstable_flames, archive_of_the_titans(20), titanic_overcharge(2)
4:49.345 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge(2)
4:49.345 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge(2)
4:50.566 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge(2)
4:51.788 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), titanic_overcharge(2)
4:53.010 filler U lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20)
4:54.241 Waiting     1.000 sec 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), archive_of_the_titans(20)
4:55.241 filler T rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), galeforce_striking, quick_navigation(2), archive_of_the_titans(20)
4:56.664 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, stormbringer, frothing_rage(2), galeforce_striking, quick_navigation(3), archive_of_the_titans(20)
4:57.890 core Q stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, quick_navigation(3), archive_of_the_titans(20)
4:59.114 core S flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage(2), galeforce_striking, quick_navigation(3), archive_of_the_titans(20), titanic_overcharge

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 6566 6148 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 1676 1464 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 20000 20000 0
Maelstrom 100 100 0
Spell Power 8540 7341 0
Crit 22.86% 22.86% 926
Haste 19.31% 19.31% 1313
Damage / Heal Versatility 2.48% 2.48% 211
ManaReg per Second 640 640 0
Attack Power 7223 6148 0
Mastery 31.36% 31.36% 553
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Crest of the Undying Visionary
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Natural Harmony, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Flame-Sterilized Spaulders
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Azerite Empowered }
Local Chest Chainvest of Assured Quality
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Ancestral Resonance, Unstable Flames, Azerite Empowered }
Local Waist Titanspark Energy Girdle
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +96 Haste, +88 Crit }
Local Legs Blighted Anima Greaves
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +149 Haste, +96 Vers }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Oblivion Crushers
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Mother's Twin Gaze
ilevel: 385, weapon: { 424 - 547, 2.6 }, stats: { +164 Agi, +277 Sta, +69 Haste, +53 Crit }, enchant: galeforce_striking
Local Off Hand Mother's Twin Gaze
ilevel: 385, weapon: { 424 - 547, 2.6 }, stats: { +164 Agi, +277 Sta, +69 Haste, +53 Crit }, enchant: quick_navigation

Talents

Level
15 Boulderfist (Enhancement Shaman) Hot Hand (Enhancement Shaman) Lightning Shield (Enhancement Shaman)
30 Landslide (Enhancement Shaman) Forceful Winds (Enhancement Shaman) Totem Mastery (Enhancement Shaman)
45 Spirit Wolf (Enhancement Shaman) Earth Shield (Enhancement Shaman) Static Charge (Enhancement Shaman)
60 Searing Assault (Enhancement Shaman) Hailstorm (Enhancement Shaman) Overcharge (Enhancement Shaman)
75 Nature's Guardian Feral Lunge (Enhancement Shaman) Wind Rush Totem
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Elemental Spirits (Enhancement Shaman) Earthen Spike (Enhancement Shaman) Ascendance (Enhancement Shaman)

Profile

shaman="T22_Shaman_Enhancement"
spec=enhancement
level=120
race=troll
role=attack
position=back
talents=3101033

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck35,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>35))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool80,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>80)))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>70)))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>60)))
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/call_action_list,name=asc,if=buff.ascendance.up
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.asc=crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
actions.asc+=/rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
actions.asc+=/windstrike

actions.buffs=crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
actions.buffs+=/rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
actions.buffs+=/fury_of_air,if=!ticking&maelstrom>=20
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck25
actions.buffs+=/flametongue,if=buff.flametongue.remains<4.8+gcd
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8+gcd&variable.furyCheck25
actions.buffs+=/totem_mastery,if=buff.resonance_totem.remains<2

# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions.cds=bloodlust,if=target.health.pct<25|time>0.500
actions.cds+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.cds+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.cds+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.cds+=/feral_spirit
actions.cds+=/ascendance,if=cooldown.strike.remains>0
actions.cds+=/earth_elemental

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/stormstrike,cycle_targets=1,if=azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
actions.core+=/stormstrike,if=buff.stormbringer.up|(buff.gathering_storms.up&variable.OCPool70&variable.furyCheck35)
actions.core+=/crash_lightning,if=active_enemies>=3&variable.furyCheck25
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&active_enemies=1&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=variable.OCPool70&variable.furyCheck35
actions.core+=/sundering
actions.core+=/crash_lightning,if=talent.forceful_winds.enabled&active_enemies>1&variable.furyCheck25
actions.core+=/flametongue,if=talent.searing_assault.enabled
actions.core+=/lava_lash,if=buff.hot_hand.react
actions.core+=/crash_lightning,if=active_enemies>1&variable.furyCheck25

actions.filler=rockbiter,if=maelstrom<70
actions.filler+=/crash_lightning,if=talent.crashing_storm.enabled&variable.OCPool60
actions.filler+=/lava_lash,if=variable.OCPool80&variable.furyCheck45
actions.filler+=/rockbiter
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<gcd

head=crest_of_the_undying_visionary,id=160630,bonus_id=4824/1507/4775,azerite_powers=416/30/0/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=flamesterilized_spaulders,id=160632,bonus_id=4824/1507/4775,azerite_powers=483/21/0/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chainvest_of_assured_quality,id=160627,bonus_id=4824/1507/4775,azerite_powers=447/459/0/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=oblivion_crushers,id=160721,bonus_id=4800/1507
waist=titanspark_energy_girdle,id=160633,bonus_id=4800/1507
legs=blighted_anima_greaves,id=160716,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=mothers_twin_gaze,id=160682,bonus_id=4800/1507,enchant=galeforce_striking
off_hand=mothers_twin_gaze,id=160682,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=926
# gear_haste_rating=1313
# gear_mastery_rating=553
# gear_versatility_rating=211
# gear_armor=2738

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 205843184
Max Event Queue: 296
Sim Seconds: 2250297
CPU Seconds: 326.0099
Physical Seconds: 163.5262
Speed Up: 6903

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
T22_Death_Knight_Blood T22_Death_Knight_Blood augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood auto_attack_mh 0 738293 2461 25.05 4752 9503 125.2 125.2 24.4% 0.0% 0.0% 3.0% 2.40sec 1065140 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_boil 50842 322995 1077 11.24 4595 9182 56.2 56.2 25.1% 0.0% 0.0% 0.0% 5.34sec 322995 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_plague ticks -55078 117444 391 19.75 949 1897 56.2 98.8 25.4% 0.0% 0.0% 0.0% 5.34sec 117444 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_shield 77535 6660 22 31.54 42 0 44.4 157.7 0.0% 0.0% 0.0% 0.0% 6.55sec 3461595 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood dancing_rune_weapon 49028 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.30sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_and_decay 43265 112595 375 32.77 549 1097 15.2 163.9 25.3% 0.0% 0.0% 0.0% 19.48sec 112595 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_strike 49998 540616 1802 8.88 9802 19601 44.4 44.4 24.5% 0.0% 0.0% 3.1% 6.55sec 780025 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_strike_heal 45470 9685 32 8.88 218 0 44.4 44.4 0.0% 0.0% 0.0% 0.0% 6.55sec 1076175 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood heart_strike 206930 280158 934 17.41 2589 5177 87.1 87.1 24.7% 0.0% 0.0% 3.0% 3.39sec 404132 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood marrowrend 195182 118499 395 4.74 4044 8072 23.7 23.7 24.1% 0.0% 0.0% 3.0% 12.84sec 170952 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood mind_freeze 47528 0 0 0.00 0 0 10.6 0.0 0.0% 0.0% 0.0% 0.0% 29.39sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood rune_strike 210764 65513 218 1.61 6565 13114 8.0 8.0 24.6% 0.0% 0.0% 2.9% 38.23sec 94467 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood touch_of_the_grave 127802 68214 227 3.59 3035 6065 18.0 18.0 25.1% 0.0% 0.0% 0.0% 17.04sec 68214 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood unholy_strength 53365 3615 12 4.75 152 0 23.7 23.7 0.0% 0.0% 0.0% 0.0% 12.66sec 447417 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood wasting_infection ticks -278110 29920 100 8.64 553 1105 7.8 43.2 25.3% 0.0% 0.0% 0.0% 35.63sec 29920 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon blood_boil 50842 7667 324 8.69 1811 3614 3.4 3.4 23.4% 0.0% 0.0% 0.0% 75.61sec 7667 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon blood_plague ticks -55078 10140 34 4.52 358 715 3.4 22.6 25.3% 0.0% 0.0% 0.0% 75.61sec 10140 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon death_strike 49998 17154 724 9.68 3578 7153 3.8 3.8 25.5% 0.0% 0.0% 0.0% 42.29sec 24524 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon heart_strike 206930 9676 408 19.60 998 1995 7.7 7.7 25.3% 0.0% 0.0% 0.0% 35.30sec 13833 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon main_hand 0 18625 786 20.07 1882 3766 7.9 7.9 24.8% 0.0% 0.0% 0.0% 34.79sec 26627 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon marrowrend 195182 7294 308 9.49 1589 3180 3.7 3.7 22.4% 0.0% 0.0% 0.0% 43.24sec 10428 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon rune_strike 210764 6446 272 5.07 2594 5182 2.0 2.0 24.3% 0.0% 0.0% 0.0% 2.47sec 9215 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_bloodworm main_hand 0 266924 1357 122.23 532 1063 400.6 400.6 25.3% 0.0% 0.0% 0.0% 0.74sec 381600 196.64sec
T22_Priest_Shadow T22_Priest_Shadow augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow dark_ascension 280711 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.39sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow dark_ascension_damage 280800 136099 454 2.18 8589 25583 5.5 10.9 22.9% 0.0% 0.0% 0.0% 60.39sec 136099 300.00sec
T22_Priest_Shadow T22_Priest_Shadow flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow heed_my_call 271685 43175 144 1.47 4823 9649 7.4 7.4 21.7% 0.0% 0.0% 0.0% 37.27sec 43175 300.00sec
T22_Priest_Shadow T22_Priest_Shadow heed_my_call_aoe 271686 18528 62 1.47 2067 4135 7.4 7.4 21.9% 0.0% 0.0% 0.0% 37.27sec 18528 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mind_blast 205351 765792 2553 10.04 12460 24808 49.2 50.2 22.6% 0.0% 0.0% 0.0% 5.99sec 765792 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mind_flay ticks -15407 732682 2442 39.63 3018 6001 76.2 198.1 22.8% 0.0% 0.0% 0.0% 3.83sec 732682 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.67sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 20.76sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_crash_damage 205386 163597 545 2.95 9156 18246 14.7 14.7 21.5% 0.0% 0.0% 0.0% 20.76sec 163597 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_word_pain 589 18138 60 1.51 1977 3949 7.5 7.5 21.8% 0.0% 0.0% 0.0% 41.40sec 463964 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_word_pain ticks -589 445826 1486 38.48 1901 3789 7.5 192.4 22.0% 0.0% 0.0% 0.0% 41.40sec 463964 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowy_apparitions 78203 0 0 0.00 0 0 42.4 0.0 0.0% 0.0% 0.0% 0.0% 6.86sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowy_apparition 148859 76274 254 8.36 1824 0 41.8 41.8 0.0% 0.0% 0.0% 0.0% 6.84sec 76274 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow vampiric_touch ticks -34914 381014 1270 25.41 2460 4898 5.9 127.1 22.1% 0.0% 0.0% 0.0% 54.19sec 381014 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_bolt 205448 829715 2766 12.73 10803 21553 63.8 63.7 20.8% 0.0% 0.0% 0.0% 4.70sec 829715 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_eruption 228260 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 60.06sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_eruption_damage 228360 116872 390 1.94 8389 25033 4.9 9.7 22.1% 0.0% 0.0% 0.0% 60.06sec 116872 300.00sec
T22_Priest_Shadow T22_Priest_Shadow_mindbender melee 0 385498 4857 52.83 4589 9174 69.9 69.9 20.2% 0.0% 0.0% 0.0% 4.05sec 385498 79.37sec
T22_Rogue_Assassination T22_Rogue_Assassination augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination auto_attack_mh 0 627217 2091 51.26 2327 4652 256.3 256.3 24.2% 19.0% 0.0% 0.0% 1.17sec 896683 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination auto_attack_oh 1 311129 1037 50.87 1163 2324 254.3 254.3 24.2% 19.0% 0.0% 0.0% 1.18sec 444796 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 240.20sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination deadly_poison_dot ticks -2818 325971 1087 39.55 1328 2655 542.1 197.7 24.1% 0.0% 0.0% 0.0% 0.71sec 325971 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination deadly_poison_instant 113780 653264 2178 108.23 972 1943 541.1 541.1 24.2% 0.0% 0.0% 0.0% 0.71sec 653264 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination envenom 32645 780560 2602 7.81 16102 32184 39.0 39.0 24.2% 0.0% 0.0% 0.0% 7.60sec 780560 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination frenetic_blow 278148 86135 287 0.72 19413 38825 3.6 3.6 24.1% 0.0% 0.0% 0.0% 73.03sec 123140 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination garrote ticks -703 715421 2385 39.62 2904 5813 16.9 198.1 24.3% 0.0% 0.0% 0.0% 18.10sec 715421 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate 1329 0 0 0.00 0 0 94.0 0.0 0.0% 0.0% 0.0% 0.0% 3.19sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate_mh 5374 435117 1450 18.81 3720 7441 94.0 94.0 24.4% 0.0% 0.0% 0.0% 3.19sec 622051 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate_oh 27576 217336 724 18.81 1860 3721 94.0 94.0 24.2% 0.0% 0.0% 0.0% 3.19sec 310708 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination poison_bomb 255546 120761 403 7.89 2466 4930 39.4 39.4 24.2% 0.0% 0.0% 0.0% 6.49sec 120761 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination rupture ticks -1943 578338 1928 39.27 2371 4743 13.3 196.3 24.2% 0.0% 0.0% 0.0% 22.51sec 578338 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination toxic_blade 245388 153549 512 2.44 10115 20230 12.2 12.2 24.4% 0.0% 0.0% 0.0% 25.17sec 153549 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.82sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination vendetta 79140 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.10sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw adrenaline_rush 13750 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 71.80sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw ambush 8676 73400 245 1.35 8502 17281 6.8 6.8 27.0% 0.0% 0.0% 0.0% 56.25sec 104934 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw auto_attack_mh 0 819668 2732 49.36 2988 6094 246.8 246.8 29.0% 19.0% 0.0% 0.0% 1.22sec 1171814 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw auto_attack_oh 1 405349 1351 48.79 1494 3047 243.9 243.9 29.1% 19.0% 0.0% 0.0% 1.23sec 579495 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw between_the_eyes 199804 223794 746 1.67 7518 31060 8.3 8.3 82.2% 0.0% 0.0% 0.0% 24.14sec 319941 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw dispatch 2098 1123504 3745 11.99 14428 29477 59.9 59.9 28.7% 0.0% 0.0% 0.0% 4.89sec 1606183 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw frenetic_blow 278148 103543 345 0.80 19652 40088 4.0 4.0 30.4% 0.0% 0.0% 0.0% 66.47sec 148027 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree 51690 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 49.95sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree_mh ticks -57841 94215 314 0.00 2146 4374 33.5 0.0 29.9% 0.0% 0.0% 0.0% 7.13sec 134692 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree_oh ticks -57842 94213 314 0.00 2146 4375 33.5 0.0 29.9% 0.0% 0.0% 0.0% 7.13sec 134688 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw main_gauche 86392 727766 2426 27.21 4089 8337 136.0 136.0 29.7% 0.0% 0.0% 0.0% 2.32sec 1040429 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw pistol_shot 185763 533032 1777 10.50 7769 15795 52.5 52.5 29.7% 0.0% 0.0% 0.0% 5.64sec 762033 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw roll_the_bones 193316 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 20.01sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw sinister_strike 193315 979308 3264 37.40 3995 8122 187.0 187.0 30.1% 0.0% 0.0% 0.0% 2.22sec 1400038 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw vanish 1856 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 56.25sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety arcane_torrent 25046 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 91.14sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety auto_attack_mh 0 585676 1952 47.27 2352 4703 236.3 236.3 24.4% 19.0% 0.0% 0.0% 1.27sec 753479 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety auto_attack_oh 1 290858 970 46.94 1176 2352 234.7 234.7 24.4% 19.0% 0.0% 0.0% 1.28sec 374236 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety backstab 53 466413 1555 13.24 5667 11336 66.2 66.2 24.3% 0.0% 0.0% 0.0% 4.24sec 608225 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety eviscerate 196819 2009316 6698 12.51 25826 51679 62.5 62.5 24.4% 0.0% 0.0% 0.0% 4.79sec 2571275 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety frenetic_blow 278148 73365 245 0.62 19129 38257 3.1 3.1 24.4% 0.0% 0.0% 0.0% 80.31sec 104884 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety marked_for_death 137619 0 0 0.00 0 0 9.8 0.0 0.0% 0.0% 0.0% 0.0% 34.15sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety nightblade ticks -195452 631643 2105 36.01 2822 5645 19.8 180.0 24.3% 0.0% 0.0% 0.0% 15.08sec 631643 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_blades 121471 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.29sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_blades_attack 279043 119993 400 4.42 5424 0 22.1 22.1 0.0% 0.0% 0.0% 0.0% 9.77sec 119993 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_dance 185313 0 0 0.00 0 0 23.0 0.0 0.0% 0.0% 0.0% 0.0% 13.31sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadowstrike 185438 994249 3314 17.80 8989 17977 89.0 89.0 24.3% 0.0% 0.0% 0.0% 3.40sec 1267072 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety symbols_of_death 212283 0 0 0.00 0 0 10.3 0.0 0.0% 0.0% 0.0% 0.0% 30.29sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety vanish 1856 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 131.45sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.93sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 192.85sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.49sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement earth_elemental 188616 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.47sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.46sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flametongue 193796 62435 208 5.69 1749 3496 28.5 28.5 25.5% 0.0% 0.0% 0.0% 10.67sec 62435 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flametongue_attack 10444 276066 920 138.57 317 634 692.8 692.8 25.6% 0.0% 0.0% 0.0% 0.66sec 276066 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement searing_assault ticks -268429 225936 753 16.86 2132 4265 28.5 84.3 25.7% 0.0% 0.0% 0.0% 10.67sec 225936 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement frenetic_blow 278148 89165 297 0.73 19449 38899 3.6 3.6 26.0% 0.0% 0.0% 0.0% 71.98sec 127472 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement lava_lash 60103 430448 1435 10.81 6342 12682 54.1 54.1 25.6% 0.0% 0.0% 0.0% 5.24sec 430448 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement lightning_shield 273324 236261 788 51.19 735 1468 256.9 255.9 25.7% 0.0% 0.0% 0.0% 1.69sec 236261 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement main_hand 0 473931 1580 31.54 2818 5636 157.7 157.7 25.6% 19.0% 0.0% 0.0% 1.91sec 677542 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement offhand 1 236562 789 31.49 1409 2818 157.4 157.4 25.6% 19.0% 0.0% 0.0% 1.91sec 338194 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement rockbiter 193786 314404 1048 12.52 4001 8002 62.6 62.6 25.6% 0.0% 0.0% 0.0% 4.83sec 314404 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 86.3 0.0 0.0% 0.0% 0.0% 0.0% 3.44sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike_mh 32175 1070354 3568 17.27 9865 19693 86.3 86.3 25.8% 0.0% 0.0% 0.0% 3.44sec 1530199 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike_offhand 32176 535231 1784 17.27 4930 9860 86.3 86.3 25.8% 0.0% 0.0% 0.0% 3.44sec 765178 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement sundering 197214 201029 670 1.47 21787 43511 7.4 7.4 25.2% 0.0% 0.0% 0.0% 42.10sec 201029 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement wind_shear 57994 0 0 0.00 0 0 11.4 0.0 0.0% 0.0% 0.0% 0.0% 27.19sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windfury_attack 25504 109789 366 26.95 649 1297 134.7 134.7 25.6% 0.0% 0.0% 0.0% 4.40sec 156956 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windlash 114089 116771 389 4.26 4366 8731 21.3 21.3 25.6% 0.0% 0.0% 0.0% 9.63sec 116771 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windlash_offhand 114093 57866 193 4.22 2183 4365 21.1 21.1 25.6% 0.0% 0.0% 0.0% 9.72sec 57866 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike 115356 0 0 0.00 0 0 18.3 0.0 0.0% 0.0% 0.0% 0.0% 11.26sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike_mh 115357 356882 1190 3.67 15430 30943 18.3 18.3 26.0% 0.0% 0.0% 0.0% 11.26sec 356882 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike_offhand 115360 177958 593 3.67 7718 15455 18.3 18.3 25.7% 0.0% 0.0% 0.0% 11.26sec 177958 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement_greater_earth_elemental melee 0 22804 312 44.58 335 669 54.3 54.3 25.6% 0.0% 0.0% 0.0% 3.38sec 32601 73.04sec
T22_Shaman_Enhancement T22_Shaman_Enhancement_spirit_wolf melee 0 103902 2379 112.19 1013 2025 81.7 81.7 25.7% 0.0% 0.0% 0.0% 6.26sec 148541 43.67sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
89679.9 0.0 Health 84.10% 5.6 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.80%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.48% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.43% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.62% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.62%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.77%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.26% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.26%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.10% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Find Weakness 9.5 79.5 33.4sec 3.4sec 79.75% 81.02% 79.5(79.5) 8.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • find_weakness_1:79.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:$w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Shadowstrike and Cheap Shot reveal a flaw in your target's defenses, causing all your attacks to bypass $91021s1% of that enemy's armor for {$91021d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Marked for Death 1.0 8.8 150.0sec 34.1sec 100.00% 0.00% 8.8(8.8) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • marked_for_death_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Toxic Blade 12.2 0.0 25.2sec 25.2sec 36.16% 39.34% 0.0(0.0) 11.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_toxic_blade
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • toxic_blade_1:36.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:245389
  • name:Toxic Blade
  • tooltip:$s1% increased damage taken from poisons from the casting Rogue.
  • description:{$@spelldesc245388=Stab your enemy with a toxic poisoned blade, dealing $s2 Nature damage. Your Nature damage done against the target is increased by $245389s1% for {$245389d=9 seconds}. |cFFFFFFFFAwards $s3 combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:9.00
  • cooldown:0.00
  • default_chance:0.00%
Vendetta 3.0 0.0 120.1sec 120.1sec 19.35% 16.64% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vendetta_1:19.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${$256495s1*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your $?c1[Chaos][Fire] damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 89679.88
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 91120.11
Minimum 85991.98
Maximum 97815.75
Spread ( max - min ) 11823.77
Range [ ( max - min ) / 2 * 100% ] 6.49%
Standard Deviation 1645.2172
5th Percentile 88642.38
95th Percentile 93960.60
( 95th Percentile - 5th Percentile ) 5318.22
Mean Distribution
Standard Deviation 18.9986
95.00% Confidence Intervall ( 91082.88 - 91157.35 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1253
0.1 Scale Factor Error with Delta=300 23107
0.05 Scale Factor Error with Delta=300 92426
0.01 Scale Factor Error with Delta=300 2310629
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 3774
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=102.749,attack_speed=2,aoe_tanks=1
2 7.77 spell_dot,damage=410.997,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 8.50 spell_nuke,damage=154.124,cooldown=35,attack_speed=2,aoe_tanks=1
4 10.68 melee_nuke,damage=308.248,cooldown=27,attack_speed=2,aoe_tanks=1

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 21668414 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste inf% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3336 3336
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=102.749,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=410.997,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=154.124,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=308.248,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.