SimulationCraft 1005-01

for World of Warcraft 10.0.5.48069 Live (hotfix 2023-02-15/48069, git build 6df5d73bd4)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 43782 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43782.4 43782.4 48.1 / 0.110% 8300.5 / 19.0% 3429.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.5 12.8 Runic Power 7.48% 51.0 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 43782
Abomination Limb 0 (525) 0.0% (1.2%) 3.0 120.35sec 52062 42290

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2313 0.0000 0.00 0.00 0.00% 42289.98 42289.98

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [e]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [f]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 525 1.2% 38.3 6.90sec 4072 0 Direct 38.3 3191 6443 4072 27.1% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.28 38.28 0.00 0.00 0.00 0.0000 0.0000 155880.85 155880.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.92% 27.91 13 37 3191.33 2279 5346 3191.48 2675 3765 89079 89079 0.00%
crit 27.08% 10.37 2 21 6443.40 4559 10562 6445.19 4819 9282 66802 66802 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2558 5.8% 192.5 1.82sec 3983 2204 Direct 192.5 3572 7187 3983 27.5% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 192.49 192.49 0.00 0.00 0.00 1.8070 0.0000 766733.65 1095361.71 30.00% 2204.33 2204.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.19% 108.16 67 157 3572.10 2435 6067 3571.94 3293 3861 386343 551932 30.00%
crit 27.50% 52.93 24 87 7186.82 4870 12546 7184.29 6528 7950 380391 543429 30.00%
miss 16.32% 31.41 13 61 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1243 2.8% 188.1 1.82sec 1982 1097 Direct 188.1 1786 3593 1982 27.5% 16.8%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 188.08 188.08 0.00 0.00 0.00 1.8068 0.0000 372791.58 532572.98 30.00% 1097.07 1097.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.75% 104.85 67 148 1785.81 1217 3105 1785.75 1652 1924 187248 267504 30.00%
crit 27.46% 51.64 27 82 3593.01 2435 6273 3592.07 3262 3949 185543 265068 30.00%
miss 16.79% 31.58 12 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (11223) 0.0% (25.6%) 2.9 120.81sec 1144458 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [i]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 11223 25.6% 200.9 1.41sec 16753 0 Direct 200.9 13103 26328 16752 27.6% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 200.86 200.86 0.00 0.00 0.00 0.0000 0.0000 3365001.51 3365001.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.41% 145.44 66 223 13103.47 7338 23857 13114.03 12098 14389 1905751 1905751 0.00%
crit 27.59% 55.43 20 95 26327.81 14675 47467 26349.47 23747 29694 1459251 1459251 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 670 1.5% 2.8 119.80sec 71541 0 Direct 2.7 59537 120021 76102 27.4% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.82 2.65 0.00 0.00 0.00 0.0000 0.0000 201857.52 201857.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.61% 1.93 0 3 59537.47 22015 68019 57282.87 0 68019 114658 114658 0.00%
crit 27.39% 0.73 0 3 120021.23 44029 136038 68275.22 0 136038 87199 87199 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 20 0.0% 1.1 114.57sec 5659 4285 Direct 11.5 410 822 523 27.5% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.06 11.50 0.00 0.00 0.00 1.3212 0.0000 6021.13 6021.13 0.00% 4285.50 4285.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.46% 8.33 0 31 409.88 304 670 307.26 0 594 3416 3416 0.00%
crit 27.54% 3.17 0 15 822.25 608 1324 602.33 0 1209 2605 2605 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [W]:1.06
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 1072 2.4% 7.5 30.14sec 42467 0 Direct 7.5 33425 67192 42490 26.9% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.48 7.48 0.00 0.00 0.00 0.0000 0.0000 317742.85 453929.93 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.15% 5.47 0 9 33424.80 33171 34163 33414.85 0 34163 182831 261193 29.99%
crit 26.85% 2.01 0 7 67191.82 66341 68326 59702.88 0 68326 134912 192736 26.66%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2150 4.9% 68.3 4.38sec 9451 0 Periodic 98.8 5111 10269 6534 27.6% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.27 0.00 98.75 98.75 67.27 0.0000 2.9999 645286.60 645286.60 0.00% 2178.20 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 72.41% 71.51 42 102 5111.45 273 9583 5110.42 4689 5506 365496 365496 0.00%
crit 27.59% 27.25 11 52 10268.60 122 18792 10265.30 8877 11692 279791 279791 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 806 (1209) 1.8% (2.8%) 21.4 7.96sec 17007 12762 Direct 21.4 (42.8) 8888 17845 11339 27.4% (27.3%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.41 21.41 0.00 0.00 0.00 1.3326 0.0000 242766.68 242766.68 0.00% 12762.03 12762.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.64% 15.55 0 43 8887.65 5633 15926 8847.05 0 11498 138227 138227 0.00%
crit 27.36% 5.86 0 19 17845.17 11827 30856 17585.58 0 24877 104540 104540 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [H]:0.79
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [n]:10.84
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [r]:9.78
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 403 0.9% 21.4 7.96sec 5668 0 Direct 21.4 4443 8927 5668 27.3% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.41 21.41 0.00 0.00 0.00 0.0000 0.0000 121359.59 121359.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.68% 15.56 0 42 4443.16 2816 7963 4421.15 0 5576 69141 69141 0.00%
crit 27.32% 5.85 0 18 8926.89 5745 15843 8799.99 0 13502 52218 52218 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6637 (8028) 15.2% (18.3%) 68.3 4.38sec 35234 28841 Direct 68.3 (136.4) 22791 45885 29130 27.4% (27.5%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.27 68.27 0.00 0.00 0.00 1.2217 0.0000 1988825.93 1988825.93 0.00% 28841.31 28841.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.55% 49.53 25 77 22790.60 3412 42458 22787.38 20075 25516 1128889 1128889 0.00%
crit 27.45% 18.74 5 42 45885.00 7818 83976 45867.39 39473 54588 859936 859936 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [S]:50.66
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [X]:0.56
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [Z]:0.72
  • if_expr:buff.rime.react
    single_target
    [m]:16.34
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1391 3.2% 68.1 4.39sec 6118 0 Direct 68.1 4787 9620 6118 27.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.12 68.12 0.00 0.00 0.00 0.0000 0.0000 416770.14 416770.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.46% 49.36 25 75 4786.95 2620 8919 4786.33 4342 5320 236277 236277 0.00%
crit 27.54% 18.76 6 36 9619.93 5241 17815 9616.43 7799 11426 180493 180493 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1527 (8378) 3.5% (19.1%) 64.2 4.62sec 39099 18966 Direct 64.2 (216.4) 5580 11218 7125 27.4% (56.9%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.24 64.24 0.00 0.00 0.00 2.0615 0.0000 457718.91 653900.83 30.00% 18965.98 18965.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.60% 46.64 20 71 5579.79 3658 9929 5581.41 5046 6165 260251 371797 30.00%
crit 27.40% 17.60 5 35 11218.07 7316 19138 11217.41 8698 13730 197468 282104 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [U]:25.34
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [V]:47.16
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Y]:9.86
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [l]:11.85
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [o]:14.00
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 764 1.7% 64.2 4.62sec 3565 0 Direct 64.2 2788 5617 3565 27.4% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.24 64.24 0.00 0.00 0.00 0.0000 0.0000 229004.83 327158.10 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.56% 46.61 17 72 2788.41 1829 4888 2789.16 2521 3095 129978 185688 30.00%
crit 27.44% 17.63 4 37 5616.71 3658 9929 5617.06 4756 6617 99027 141470 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4058 9.3% 44.0 6.73sec 27670 0 Direct 44.0 0 27670 27670 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.97 43.97 0.00 0.00 0.00 0.0000 0.0000 1216766.82 1216766.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.97 24 68 27669.84 15185 52357 27654.36 25205 30626 1216767 1216767 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2029 4.6% 44.0 6.73sec 13835 0 Direct 44.0 0 13835 13835 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.97 43.97 0.00 0.00 0.00 0.0000 0.0000 608383.41 608383.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.97 24 68 13834.92 7593 26179 13827.18 12602 15313 608383 608383 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5321) 0.0% (12.2%) 15.1 20.50sec 105779 84526

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.08 0.00 0.00 0.00 0.00 1.2514 0.0000 0.00 0.00 0.00% 84525.94 84525.94

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [R]:9.49
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [k]:5.60
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5321 12.2% 246.5 1.21sec 6471 0 Direct 246.5 5059 10188 6471 27.5% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 246.54 246.54 0.00 0.00 0.00 0.0000 0.0000 1595427.06 1595427.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.47% 178.66 118 236 5059.19 1070 11789 5056.54 4347 5704 903886 903886 0.00%
crit 27.53% 67.88 36 110 10188.21 2141 23115 10183.36 8345 12033 691541 691541 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 200 0.5% 20.3 14.36sec 2961 0 Direct 20.3 2314 4651 2961 27.7% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.28 20.28 0.00 0.00 0.00 0.0000 0.0000 60063.16 85806.71 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.30% 14.67 3 34 2313.69 2296 2365 2313.71 2296 2365 33932 48476 30.00%
crit 27.70% 5.62 0 15 4651.35 4593 4730 4631.85 0 4730 26131 37331 29.88%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 200 0.5% 20.3 14.39sec 2954 0 Direct 20.3 2314 4651 2953 27.4% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.28 20.28 0.00 0.00 0.00 0.0000 0.0000 59911.34 85589.81 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.62% 14.73 4 30 2313.57 2296 2365 2313.65 2296 2365 34080 48687 30.00%
crit 27.38% 5.55 0 16 4650.60 4593 4730 4636.59 0 4730 25832 36903 29.91%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1805 / 986
Claw 593 0.7% 52.5 5.36sec 1848 1848 Direct 52.5 1449 2898 1848 27.5% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.51 52.51 0.00 0.00 0.00 1.0000 0.0000 97019.33 138602.57 30.00% 1847.56 1847.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.47% 38.05 21 54 1448.62 910 2404 1449.76 1306 1598 55127 78754 30.00%
crit 27.53% 14.46 3 28 2897.61 1820 4751 2900.32 2280 3504 41893 59848 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.51
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.50sec 63 63 Direct 2.9 50 99 63 27.4% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 184.88 264.12 30.00% 63.12 63.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.57% 2.13 0 3 49.56 32 66 48.35 0 65 105 151 29.26%
crit 27.43% 0.80 0 3 98.92 64 132 60.08 0 132 80 114 18.22%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 1211 1.5% 95.4 2.90sec 2078 1344 Direct 95.4 1628 3256 2078 27.7% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.40 95.40 0.00 0.00 0.00 1.5468 0.0000 198288.51 283276.53 30.00% 1343.66 1343.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.31% 68.99 40 92 1627.57 1011 2671 1629.09 1483 1779 112285 160412 30.00%
crit 27.69% 26.42 7 46 3255.76 2023 5490 3258.96 2817 3730 86003 122865 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Anti-Magic Shell 5.0 65.92sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 5.05 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:5.05
  • if_expr:runic_power.deficit>40
Arcane Torrent 2.1 134.72sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.12 0.00 0.00 0.00 0.00 1.2904 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [a]:1.42
  • if_expr:runic_power<60
    single_target
    [q]:0.70
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 85.77sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [c]:0.38
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [d]:3.57
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 5.0 60.97sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.96 0.00 0.00 0.00 0.00 1.2245 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [T]:4.51
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [p]:0.45
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 7.9 39.70sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [g]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [h]:7.61
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.5 306.51sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [b]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.49sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [j]:2.98
Unholy Strength 20.3 14.36sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.32 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.3sec 120.4sec 11.8sec 11.89% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.89%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 5.0 0.0 64.8sec 65.9sec 5.0sec 8.34% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 144.9s
  • trigger_min/max:60.0s / 144.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • antimagic_shell_1:8.34%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.2 31.8 25.1sec 6.7sec 19.4sec 78.55% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 75.4s
  • trigger_min/max:0.9s / 51.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.6s

Stack Uptimes

  • bonegrinder_crit_1:24.58%
  • bonegrinder_crit_2:18.88%
  • bonegrinder_crit_3:14.55%
  • bonegrinder_crit_4:11.38%
  • bonegrinder_crit_5:9.16%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 4.1 0.0 63.6sec 63.6sec 9.8sec 13.38% 38.92% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.7s / 317.0s
  • trigger_min/max:10.7s / 317.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • bonegrinder_frost_1:13.38%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.8 13.9 120.7sec 14.9sec 19.4sec 18.22% 0.00% 1.8 (1.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 151.0s
  • trigger_min/max:0.0s / 137.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.89%
  • bound_by_fire_and_blaze_2:4.15%
  • bound_by_fire_and_blaze_3:4.01%
  • bound_by_fire_and_blaze_4:3.50%
  • bound_by_fire_and_blaze_5:2.56%
  • bound_by_fire_and_blaze_6:3.12%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.8sec 120.8sec 68.2sec 66.88% 0.00% 200.3 (200.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 203.6s
  • trigger_min/max:120.0s / 203.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 198.0s

Stack Uptimes

  • breath_of_sindragosa_1:66.88%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 3.0 0.0 120.3sec 120.4sec 0.7sec 0.73% 0.00% 7.5 (7.5) 3.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.86
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s

Stack Uptimes

  • dragon_games_equipment_1:0.73%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 122.7sec 98.6sec 57.9sec 24.66% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 310.4s

Stack Uptimes

  • elemental_chaos_air_1:24.66%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.4sec 98.9sec 58.2sec 25.24% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 302.0s

Stack Uptimes

  • elemental_chaos_earth_1:25.24%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 122.4sec 98.8sec 57.9sec 24.87% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 286.8s

Stack Uptimes

  • elemental_chaos_fire_1:24.87%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.1sec 98.2sec 57.7sec 25.23% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.23%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.5sec 306.5sec 26.9sec 12.78% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 330.8s
  • trigger_min/max:300.0s / 330.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.78%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 85.7sec 85.7sec 19.5sec 25.91% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.1s / 209.0s
  • trigger_min/max:0.0s / 209.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:25.91%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.6 0.0 39.7sec 39.7sec 12.2sec 30.99% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.1s / 56.4s
  • trigger_min/max:27.1s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:30.99%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 7.8 17.3 40.1sec 11.5sec 9.6sec 25.03% 98.57% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.5s / 122.1s
  • trigger_min/max:0.9s / 111.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:9.83%
  • enduring_strength_builder_2:7.75%
  • enduring_strength_builder_3:4.60%
  • enduring_strength_builder_4:2.02%
  • enduring_strength_builder_5:0.63%
  • enduring_strength_builder_6:0.16%
  • enduring_strength_builder_7:0.03%
  • enduring_strength_builder_8:0.00%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Storm 13.4 131.0 23.1sec 2.1sec 15.5sec 69.22% 87.04% 70.6 (110.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.7s / 86.5s
  • trigger_min/max:0.9s / 32.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.5s

Stack Uptimes

  • gathering_storm_1:2.25%
  • gathering_storm_2:4.92%
  • gathering_storm_3:5.26%
  • gathering_storm_4:3.23%
  • gathering_storm_5:5.00%
  • gathering_storm_6:4.05%
  • gathering_storm_7:3.42%
  • gathering_storm_8:3.82%
  • gathering_storm_9:3.13%
  • gathering_storm_10:34.13%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 2.0 219.8 133.5sec 1.3sec 149.1sec 97.14% 81.30% 215.9 (215.9) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 347.0s
  • trigger_min/max:1.0s / 19.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.0s

Stack Uptimes

  • icy_talons_1:0.90%
  • icy_talons_2:0.70%
  • icy_talons_3:95.54%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 44.2 7.7 6.7sec 5.7sec 1.6sec 24.25% 40.66% 7.7 (7.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 48.0s
  • trigger_min/max:0.0s / 47.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.5s

Stack Uptimes

  • killing_machine_1:24.25%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 7.9 0.0 39.7sec 39.7sec 11.8sec 31.12% 28.97% 0.0 (0.0) 7.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.1s / 56.4s
  • trigger_min/max:27.1s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:31.12%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 7.9 58.4 39.7sec 4.3sec 11.5sec 30.48% 51.26% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.5s / 56.4s
  • trigger_min/max:0.9s / 46.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.03%
  • pillar_of_frost_bonus_2:2.43%
  • pillar_of_frost_bonus_3:2.91%
  • pillar_of_frost_bonus_4:2.41%
  • pillar_of_frost_bonus_5:2.52%
  • pillar_of_frost_bonus_6:2.72%
  • pillar_of_frost_bonus_7:2.37%
  • pillar_of_frost_bonus_8:2.33%
  • pillar_of_frost_bonus_9:2.16%
  • pillar_of_frost_bonus_10:1.81%
  • pillar_of_frost_bonus_11:1.72%
  • pillar_of_frost_bonus_12:1.48%
  • pillar_of_frost_bonus_13:1.16%
  • pillar_of_frost_bonus_14:0.85%
  • pillar_of_frost_bonus_15:0.49%
  • pillar_of_frost_bonus_16:0.31%
  • pillar_of_frost_bonus_17:0.24%
  • pillar_of_frost_bonus_18:0.19%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.13%
  • pillar_of_frost_bonus_21:0.05%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.5 1.6 23.1sec 20.5sec 17.1sec 76.93% 0.00% 225.5 (225.5) 12.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 85.4s
  • trigger_min/max:20.0s / 27.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.5s

Stack Uptimes

  • remorseless_winter_1:76.93%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 68.4 5.4 4.4sec 4.1sec 1.4sec 31.50% 99.78% 5.4 (5.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 47.9s
  • trigger_min/max:0.0s / 47.9s
  • trigger_pct:63.10%
  • duration_min/max:0.0s / 16.2s

Stack Uptimes

  • rime_1:31.50%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.7 15.2 21.8sec 10.1sec 12.0sec 54.84% 0.00% 15.2 (15.2) 13.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 137.3s
  • trigger_min/max:0.9s / 137.3s
  • trigger_pct:15.02%
  • duration_min/max:0.0s / 83.8s

Stack Uptimes

  • rune_mastery_1:54.84%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.6 23.3sec 14.3sec 10.2sec 43.61% 42.93% 7.6 (7.6) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 79.2s
  • trigger_min/max:0.0s / 59.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.7s

Stack Uptimes

  • rune_of_hysteria_1:43.61%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.5 11.8 35.7sec 14.3sec 23.6sec 66.70% 0.00% 11.8 (11.8) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 201.2s
  • trigger_min/max:0.0s / 68.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 187.3s

Stack Uptimes

  • unholy_strength_1:66.70%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 2.0 219.8 133.5sec 1.3sec 149.1sec 97.14% 96.24% 215.9 (215.9) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 347.0s
  • trigger_min/max:1.0s / 19.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.0s

Stack Uptimes

  • unleashed_frenzy_1:0.90%
  • unleashed_frenzy_2:0.70%
  • unleashed_frenzy_3:95.54%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.9 8.0 48.0 10.9s 1.3s 123.5s
windfury_totem_extra_attack_oh 22.4 6.0 46.0 13.0s 1.3s 142.5s
Killing Machine spent on Obliterate 44.0 24.0 68.0 6.7s 0.9s 51.3s
Killing Machine: Critical auto attacks 44.2 25.0 68.0 6.7s 1.3s 48.0s
Killing Machine wasted: Critical auto attacks 7.7 0.0 21.0 34.2s 1.3s 288.3s
Rune ready 228.6 157.0 293.0 1.4s 0.0s 11.6s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 5.85% 0.11% 20.67% 1.1s 0.0s 10.5s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=329453)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0621.163 / 0.9303.10616.825
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
9.57526.82551.100 / 49.32980.293131.668

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Anti-Magic Shell5.7060.00184.94619.4420.000100.546
Remorseless Winter0.6370.0017.4507.0701.20119.344
Horn of Winter17.4290.001128.14863.2950.000175.791
Death and Decay84.8610.126231.26926.5900.000231.269
Empower Rune Weapon9.1011.18117.0210.0020.00017.021
Abomination Limb0.5450.0012.4240.6520.0003.463
Pillar of Frost1.7810.00113.44710.6660.75427.822
Breath of Sindragosa1.0390.00183.6281.5880.00083.628
Raise Dead0.5520.0014.0310.9760.2624.339

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune10.6410.594.63%1.000.050.47%
Empower Rune WeaponRunic Power19.1187.752.28%4.597.828.18%
Empower Rune WeaponRune19.1119.058.34%1.000.060.32%
Frost FeverRunic Power32.33148.723.87%4.6012.917.99%
Horn of WinterRunic Power4.97124.133.23%25.000.000.00%
Horn of WinterRune9.939.934.34%1.000.000.00%
Murderous EfficiencyRune22.0122.019.63%1.000.000.00%
Rage of the Frozen ChampionRunic Power68.12508.1613.22%7.4636.806.75%
Rune RegenerationRune92.3392.3340.39%1.000.000.00%
Rune of HysteriaRunic Power167.71333.238.67%1.9939.4210.58%
Runic AttenuationRunic Power71.70335.238.72%4.6823.276.49%
Runic EmpowermentRune74.9374.6632.66%1.000.270.36%
Arcane TorrentRunic Power2.1242.381.10%20.000.000.00%
Death and DecayRunic Power1.0610.640.28%10.000.000.00%
Howling BlastRunic Power68.271.530.04%0.020.000.00%
ObliterateRunic Power108.222111.2554.93%19.5153.132.45%
Remorseless WinterRunic Power15.08140.223.65%9.3010.607.03%
pet - ghoul
energy_regenEnergy1112.741935.03100.00%1.74171.518.14%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 200.303204.8516.0015.961049.97
Death and DecayRune 1.061.061.001.005657.58
Frost StrikeRunic Power 21.41535.2725.0025.00680.27
Howling BlastRune 68.270.150.000.0015690761.87
ObliterateRune 108.22216.442.003.3711605.54
Remorseless WinterRune 15.0815.081.001.00105778.92
pet - ghoul
ClawEnergy 52.512100.5240.0040.0046.19
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.81 12.47 184.0 103.1 0.2 144.0
Rune 6.0 0.76 0.78 0.0 1.8 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 43782.44
Minimum 34999.05
Maximum 51587.79
Spread ( max - min ) 16588.74
Range [ ( max - min ) / 2 * 100% ] 18.94%
Standard Deviation 2125.1991
5th Percentile 40249.11
95th Percentile 47218.69
( 95th Percentile - 5th Percentile ) 6969.58
Mean Distribution
Standard Deviation 24.5413
95.00% Confidence Interval ( 43734.34 - 43830.54 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 91
0.1% Error 9051
0.1 Scale Factor Error with Delta=300 38556
0.05 Scale Factor Error with Delta=300 154221
0.01 Scale Factor Error with Delta=300 3855520
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 43782.44
Minimum 34999.05
Maximum 51587.79
Spread ( max - min ) 16588.74
Range [ ( max - min ) / 2 * 100% ] 18.94%
Standard Deviation 2125.1991
5th Percentile 40249.11
95th Percentile 47218.69
( 95th Percentile - 5th Percentile ) 6969.58
Mean Distribution
Standard Deviation 24.5413
95.00% Confidence Interval ( 43734.34 - 43830.54 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 91
0.1% Error 9051
0.1 Scale Factor Error with Delta=300 38556
0.05 Scale Factor Error with Delta=300 154221
0.01 Scale Factor Error with Delta=300 3855520
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 43782.44
Minimum 34999.05
Maximum 51587.79
Spread ( max - min ) 16588.74
Range [ ( max - min ) / 2 * 100% ] 18.94%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 12828313.57
Minimum 8612514.18
Maximum 16775723.39
Spread ( max - min ) 8163209.21
Range [ ( max - min ) / 2 * 100% ] 31.82%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
E 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
G 5.05 antimagic_shell,if=runic_power.deficit>40
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa)
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
H 0.79 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
I 0.00 call_action_list,name=trinkets
Choose Action list to run
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=racials
L 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
M 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
N 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
O 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
P 0.00 call_action_list,name=aoe,if=active_enemies>=2
Q 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
R 9.49 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
S 50.66 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
T 4.51 horn_of_winter,if=rune<2&runic_power.deficit>25
U 25.34 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
V 47.16 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
W 1.06 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
X 0.56 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
Y 9.86 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
Z 0.72 howling_blast,if=buff.rime.react
a 1.42 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
b 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
c 0.38 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
d 3.57 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
e 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
f 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
g 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
h 7.61 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
i 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
j 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
k 5.60 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
l 11.85 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
m 16.34 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
n 10.84 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
o 14.00 obliterate,if=!variable.pooling_runes
p 0.45 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
q 0.70 arcane_torrent,if=runic_power.deficit>20
r 9.78 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
s 2.82 use_item,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
t 2.99 use_item,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABCDEFGtfjklmoidhbSVSUSVSVSVSUVSUSsYRUYYSYSUYSYSUSTYRSUhSVSVSVSUVSVGVRdSVSaVVSVVSVSVSRTVhVVVSlmomlmrklmlmnrlnromltfjmkHihVSVTUSVGVSdVsVSRVSVSVYSYSYSYSYURYhSVVSTVVUURVaVZUZloGmororlkmnrhlmnlmnomnlmknnlmnomnomltfjmlkHiSUhVVSUSVSGUSsYSRUVSTUSVSVSUcVVSVhRVSUVSVSUUS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat B trinket_1_manual PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat C trinket_2_manual PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat D rw_buffs PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat E 2h_check PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
0:00.000 default F auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
0:00.000 default G antimagic_shell PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, killing_machine, elemental_chaos_frost
0:00.000 trinkets t use_item_dragon_games_equipment Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, killing_machine, elemental_chaos_frost
0:00.000 cooldowns f abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, killing_machine, dragon_games_equipment, elemental_chaos_frost
0:01.034 cooldowns j raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, abomination_limb, killing_machine, rime, elemental_chaos_frost
0:01.034 single_target k remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, abomination_limb, killing_machine, rime, elemental_chaos_frost
0:02.070 single_target l obliterate Fluffy_Pillow 15.0/144: 10% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, rune_mastery, abomination_limb, killing_machine, remorseless_winter, rime, elemental_chaos_frost
0:03.106 single_target m howling_blast Fluffy_Pillow 35.0/144: 24% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, abomination_limb, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, elemental_chaos_frost
0:04.142 single_target o obliterate Fluffy_Pillow 48.0/144: 33% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, abomination_limb, gathering_storm(3), remorseless_winter, bonegrinder_crit, elemental_chaos_frost
0:05.180 cooldowns i breath_of_sindragosa Fluffy_Pillow 68.0/144: 47% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, elemental_chaos_frost
0:05.180 cooldowns d empower_rune_weapon Fluffy_Pillow 68.0/144: 47% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, elemental_chaos_frost
0:05.180 cooldowns h pillar_of_frost Fluffy_Pillow 73.0/144: 51% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, elemental_chaos_frost
0:05.180 cooldowns b potion Fluffy_Pillow 73.0/144: 51% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, elemental_chaos_frost
0:05.180 breath S howling_blast Fluffy_Pillow 73.0/144: 51% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.082 breath V obliterate Fluffy_Pillow 86.0/144: 60% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.982 breath S howling_blast Fluffy_Pillow 95.0/144: 66% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.883 breath U obliterate Fluffy_Pillow 87.0/144: 60% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.784 breath S howling_blast Fluffy_Pillow 91.0/144: 63% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.685 breath V obliterate Fluffy_Pillow 88.0/144: 61% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.583 breath S howling_blast Fluffy_Pillow 97.0/144: 67% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.483 breath V obliterate Fluffy_Pillow 94.0/144: 65% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.383 breath S howling_blast Fluffy_Pillow 103.0/144: 72% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.284 breath V obliterate Fluffy_Pillow 95.0/144: 66% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.184 breath S howling_blast Fluffy_Pillow 99.0/144: 69% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.084 breath U obliterate Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.985 breath V obliterate Fluffy_Pillow 121.0/144: 84% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.887 breath S howling_blast Fluffy_Pillow 125.0/144: 87% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(20), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.788 Waiting     0.296 sec 125.1/144: 87% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.084 breath U obliterate Fluffy_Pillow 125.1/144: 87% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.985 breath S howling_blast Fluffy_Pillow 134.2/144: 93% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.886 Waiting     0.205 sec 128.0/144: 89% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.091 trinkets s use_item_blazebinders_hoof Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.091 Waiting     0.104 sec 128.0/144: 89% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.195 breath Y obliterate Fluffy_Pillow 118.2/144: 82% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.095 breath R remorseless_winter Fluffy_Pillow 143.0/144: 99% runic_power
2.0/6: 33% rune		 bloodlust, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.994 breath U obliterate Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune		 bloodlust, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.892 Waiting     0.301 sec 128.0/144: 89% runic_power
2.0/6: 33% rune		 bloodlust, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.193 breath Y obliterate Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune		 bloodlust, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.093 Waiting     1.092 sec 143.0/144: 99% runic_power
1.0/6: 17% rune		 bloodlust, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.185 breath Y obliterate Fluffy_Pillow 118.2/144: 82% runic_power
3.0/6: 50% rune		 bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.220 breath S howling_blast Fluffy_Pillow 127.0/144: 88% runic_power
2.0/6: 33% rune		 bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.256 Waiting     0.980 sec 127.1/144: 88% runic_power
3.0/6: 50% rune		 bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.236 breath Y obliterate Fluffy_Pillow 111.1/144: 77% runic_power
4.0/6: 67% rune		 bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.272 breath S howling_blast Fluffy_Pillow 119.9/144: 83% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.308 Waiting     0.211 sec 120.0/144: 83% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.519 breath U obliterate Fluffy_Pillow 120.0/144: 83% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:31.555 Waiting     0.671 sec 128.0/144: 89% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:32.226 breath Y obliterate Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:33.262 breath S howling_blast Fluffy_Pillow 126.0/144: 88% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:34.298 breath Y obliterate Fluffy_Pillow 118.0/144: 82% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:35.334 breath S howling_blast Fluffy_Pillow 127.0/144: 88% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost
0:36.370 breath U obliterate Fluffy_Pillow 119.0/144: 83% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost
0:37.406 breath S howling_blast Fluffy_Pillow 123.0/144: 85% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost
0:38.442 breath T horn_of_winter Fluffy_Pillow 115.0/144: 80% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost
0:39.478 Waiting     0.788 sec 124.0/144: 86% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_frost
0:40.266 breath Y obliterate Fluffy_Pillow 108.0/144: 75% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_frost
0:41.609 breath R remorseless_winter Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:42.955 breath S howling_blast Fluffy_Pillow 108.4/144: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:44.300 breath U obliterate Fluffy_Pillow 86.3/144: 60% runic_power
4.0/6: 67% rune		 rune_mastery, breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:45.643 cooldowns h pillar_of_frost Fluffy_Pillow 101.3/144: 70% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:45.643 breath S howling_blast Fluffy_Pillow 101.3/144: 70% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:46.986 breath V obliterate Fluffy_Pillow 95.2/144: 66% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:48.329 breath S howling_blast Fluffy_Pillow 94.2/144: 65% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:49.672 breath V obliterate Fluffy_Pillow 94.4/144: 66% runic_power
5.0/6: 83% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
0:51.018 breath S howling_blast Fluffy_Pillow 103.4/144: 72% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
0:52.364 breath V obliterate Fluffy_Pillow 79.4/144: 55% runic_power
5.0/6: 83% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
0:53.710 breath S howling_blast Fluffy_Pillow 83.4/144: 58% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost
0:55.055 breath U obliterate Fluffy_Pillow 80.4/144: 56% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost
0:56.401 breath V obliterate Fluffy_Pillow 68.4/144: 47% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost
0:57.746 breath S howling_blast Fluffy_Pillow 77.4/144: 54% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
0:59.091 breath V obliterate Fluffy_Pillow 74.4/144: 52% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
1:00.435 default G antimagic_shell PR_Death_Knight_Frost 67.4/144: 47% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:00.435 breath V obliterate Fluffy_Pillow 67.4/144: 47% runic_power
3.0/6: 50% rune		 antimagic_shell, breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:01.736 breath R remorseless_winter Fluffy_Pillow 71.4/144: 50% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:02.244 cooldowns d empower_rune_weapon Fluffy_Pillow 65.4/144: 45% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, breath_of_sindragosa, icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:03.036 breath S howling_blast Fluffy_Pillow 70.4/144: 49% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:04.166 breath V obliterate Fluffy_Pillow 67.4/144: 47% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:05.297 breath S howling_blast Fluffy_Pillow 55.4/144: 38% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:06.428 breath a arcane_torrent Fluffy_Pillow 47.4/144: 33% runic_power
1.0/6: 17% rune		 rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:07.561 breath V obliterate Fluffy_Pillow 61.4/144: 43% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:08.692 Waiting     0.221 sec 65.4/144: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:08.913 breath V obliterate Fluffy_Pillow 65.4/144: 45% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:10.045 breath S howling_blast Fluffy_Pillow 74.2/144: 52% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:11.176 Waiting     1.092 sec 68.1/144: 47% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:12.268 breath V obliterate Fluffy_Pillow 48.5/144: 34% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:13.399 Waiting     1.194 sec 57.3/144: 40% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:14.593 breath V obliterate Fluffy_Pillow 47.5/144: 33% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:15.726 breath S howling_blast Fluffy_Pillow 62.5/144: 43% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:16.857 Waiting     0.325 sec 56.4/144: 39% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:17.182 breath V obliterate Fluffy_Pillow 40.4/144: 28% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_air
1:18.313 breath S howling_blast Fluffy_Pillow 59.4/144: 41% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_air
1:19.442 Waiting     0.418 sec 51.4/144: 36% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_air
1:19.860 breath V obliterate Fluffy_Pillow 51.4/144: 36% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_air
1:20.992 breath S howling_blast Fluffy_Pillow 60.4/144: 42% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_air
1:22.122 breath R remorseless_winter Fluffy_Pillow 57.4/144: 40% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_air
1:23.255 breath T horn_of_winter Fluffy_Pillow 45.4/144: 32% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, icy_talons(3), remorseless_winter, unleashed_frenzy(3), elemental_chaos_air
1:24.741 breath V obliterate Fluffy_Pillow 54.4/144: 38% runic_power
5.0/6: 83% rune		 breath_of_sindragosa, icy_talons(3), remorseless_winter, unleashed_frenzy(3), elemental_chaos_air
1:26.042 cooldowns h pillar_of_frost Fluffy_Pillow 58.4/144: 41% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, unleashed_frenzy(3), elemental_chaos_air
1:26.042 breath V obliterate Fluffy_Pillow 58.4/144: 41% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, unleashed_frenzy(3), elemental_chaos_air
1:27.344 breath V obliterate Fluffy_Pillow 46.4/144: 32% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, unleashed_frenzy(3), elemental_chaos_air
1:28.644 breath V obliterate Fluffy_Pillow 55.4/144: 38% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_air
1:29.945 breath S howling_blast Fluffy_Pillow 64.4/144: 45% runic_power
0.0/6: 0% rune		 breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
1:31.247 Waiting     1.959 sec 40.4/144: 28% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
1:33.206 single_target l obliterate Fluffy_Pillow 8.4/144: 6% runic_power
3.0/6: 50% rune		 gathering_storm(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
1:34.506 single_target m howling_blast Fluffy_Pillow 28.4/144: 20% runic_power
3.0/6: 50% rune		 gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_air
1:35.806 single_target o obliterate Fluffy_Pillow 36.4/144: 25% runic_power
3.0/6: 50% rune		 unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:37.109 single_target m howling_blast Fluffy_Pillow 67.4/144: 47% runic_power
2.0/6: 33% rune		 unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:38.408 single_target l obliterate Fluffy_Pillow 77.3/144: 54% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:39.707 single_target m howling_blast Fluffy_Pillow 108.3/144: 75% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:41.006 single_target r frost_strike Fluffy_Pillow 118.2/144: 82% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:42.307 single_target k remorseless_winter Fluffy_Pillow 93.2/144: 65% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:43.607 single_target l obliterate Fluffy_Pillow 105.6/144: 73% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:44.908 single_target m howling_blast Fluffy_Pillow 125.6/144: 87% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:46.209 single_target l obliterate Fluffy_Pillow 138.6/144: 96% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:47.508 single_target m howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:48.809 single_target n frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:50.110 single_target r frost_strike Fluffy_Pillow 119.0/144: 83% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:51.411 single_target l obliterate Fluffy_Pillow 100.2/144: 70% runic_power
3.0/6: 50% rune		 rune_mastery, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:52.711 single_target n frost_strike Fluffy_Pillow 131.2/144: 91% runic_power
1.0/6: 17% rune		 rune_mastery, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:54.010 single_target r frost_strike Fluffy_Pillow 106.2/144: 74% runic_power
1.0/6: 17% rune		 gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:55.311 single_target o obliterate Fluffy_Pillow 87.4/144: 61% runic_power
3.0/6: 50% rune		 icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_air
1:56.611 single_target m howling_blast Fluffy_Pillow 107.4/144: 75% runic_power
1.0/6: 17% rune		 icy_talons(3), killing_machine, rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_air
1:57.911 Waiting     1.473 sec 120.4/144: 84% runic_power
1.0/6: 17% rune		 icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_air
1:59.384 single_target l obliterate Fluffy_Pillow 125.4/144: 87% runic_power
3.0/6: 50% rune		 icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_air
2:00.685 trinkets t use_item_dragon_games_equipment Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth
2:00.685 cooldowns f abomination_limb Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), dragon_games_equipment, elemental_chaos_earth
2:02.030 cooldowns j raise_dead Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 abomination_limb, icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth
2:02.030 single_target m howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 abomination_limb, icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth
2:03.375 single_target k remorseless_winter Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, abomination_limb, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth
2:04.720 default H frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 rune_mastery, abomination_limb, remorseless_winter, bonegrinder_frost, elemental_chaos_earth
2:06.066 cooldowns i breath_of_sindragosa Fluffy_Pillow 119.0/144: 83% runic_power
2.0/6: 33% rune		 rune_mastery, abomination_limb, icy_talons, remorseless_winter, bonegrinder_frost, unleashed_frenzy, elemental_chaos_earth
2:06.066 cooldowns h pillar_of_frost Fluffy_Pillow 119.0/144: 83% runic_power
4.0/6: 67% rune		 rune_mastery, abomination_limb, breath_of_sindragosa, icy_talons, remorseless_winter, bonegrinder_frost, unleashed_frenzy, elemental_chaos_earth
2:06.066 breath V obliterate Fluffy_Pillow 119.0/144: 83% runic_power
4.0/6: 67% rune		 rune_mastery, abomination_limb, breath_of_sindragosa, icy_talons, pillar_of_frost, remorseless_winter, bonegrinder_frost, unleashed_frenzy, elemental_chaos_earth
2:07.411 breath S howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune		 rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(2), elemental_chaos_earth
2:08.756 breath V obliterate Fluffy_Pillow 125.0/144: 87% runic_power
3.0/6: 50% rune		 rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth
2:10.100 breath T horn_of_winter Fluffy_Pillow 117.0/144: 81% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
2:11.445 breath U obliterate Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
2:12.789 Waiting     0.290 sec 138.0/144: 96% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
2:13.079 breath S howling_blast Fluffy_Pillow 122.0/144: 85% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
2:14.424 breath V obliterate Fluffy_Pillow 114.0/144: 79% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
2:15.767 Waiting     0.308 sec 118.0/144: 82% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
2:16.075 default G antimagic_shell PR_Death_Knight_Frost 102.0/144: 71% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
2:16.075 breath V obliterate Fluffy_Pillow 102.0/144: 71% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
2:17.418 breath S howling_blast Fluffy_Pillow 106.0/144: 74% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
2:18.762 Waiting     1.365 sec 98.0/144: 68% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
2:20.127 cooldowns d empower_rune_weapon Fluffy_Pillow 66.0/144: 46% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
2:20.127 breath V obliterate Fluffy_Pillow 71.0/144: 49% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
2:21.299 trinkets s use_item_blazebinders_hoof Fluffy_Pillow 80.0/144: 56% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
2:21.299 breath V obliterate Fluffy_Pillow 80.0/144: 56% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, elemental_chaos_earth
2:22.470 breath S howling_blast Fluffy_Pillow 89.0/144: 62% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth
2:23.640 breath R remorseless_winter Fluffy_Pillow 81.0/144: 56% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth
2:24.810 breath V obliterate Fluffy_Pillow 85.0/144: 59% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
2:25.980 breath S howling_blast Fluffy_Pillow 95.2/144: 66% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_earth
2:27.152 breath V obliterate Fluffy_Pillow 79.3/144: 55% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_earth
2:28.323 breath S howling_blast Fluffy_Pillow 88.1/144: 61% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_earth
2:29.492 breath V obliterate Fluffy_Pillow 88.2/144: 61% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_earth
2:30.661 breath Y obliterate Fluffy_Pillow 109.4/144: 76% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_earth
2:31.833 breath S howling_blast Fluffy_Pillow 118.2/144: 82% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_earth
2:33.003 breath Y obliterate Fluffy_Pillow 118.4/144: 82% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
2:34.173 breath S howling_blast Fluffy_Pillow 106.4/144: 74% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_earth
2:35.342 breath Y obliterate Fluffy_Pillow 106.5/144: 74% runic_power
5.0/6: 83% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_earth
2:36.512 breath S howling_blast Fluffy_Pillow 121.5/144: 84% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_earth
2:37.683 breath Y obliterate Fluffy_Pillow 115.4/144: 80% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_earth
2:38.853 breath S howling_blast Fluffy_Pillow 124.2/144: 86% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth
2:40.024 breath Y obliterate Fluffy_Pillow 118.1/144: 82% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth
2:41.195 Waiting     0.312 sec 123.3/144: 86% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth
2:41.507 breath U obliterate Fluffy_Pillow 123.3/144: 86% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:42.851 Waiting     0.619 sec 133.0/144: 92% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:43.470 breath R remorseless_winter Fluffy_Pillow 122.0/144: 85% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:44.985 breath Y obliterate Fluffy_Pillow 116.0/144: 81% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:46.331 cooldowns h pillar_of_frost Fluffy_Pillow 104.0/144: 72% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
2:46.331 breath S howling_blast Fluffy_Pillow 104.0/144: 72% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
2:47.676 Waiting     0.403 sec 96.0/144: 67% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
2:48.079 breath V obliterate Fluffy_Pillow 80.0/144: 56% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
2:49.425 Waiting     3.094 sec 89.0/144: 62% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
2:52.519 breath V obliterate Fluffy_Pillow 41.0/144: 28% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
2:53.865 breath S howling_blast Fluffy_Pillow 51.2/144: 36% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:55.210 breath T horn_of_winter Fluffy_Pillow 35.3/144: 25% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:56.555 breath V obliterate Fluffy_Pillow 50.3/144: 35% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:57.901 breath V obliterate Fluffy_Pillow 59.1/144: 41% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:59.246 Waiting     0.884 sec 51.9/144: 36% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
3:00.130 breath U obliterate Fluffy_Pillow 42.1/144: 29% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:01.474 breath U obliterate Fluffy_Pillow 55.9/144: 39% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:02.819 Waiting     0.608 sec 64.9/144: 45% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:03.427 breath R remorseless_winter Fluffy_Pillow 48.9/144: 34% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:04.988 breath V obliterate Fluffy_Pillow 42.9/144: 30% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:06.333 breath a arcane_torrent Fluffy_Pillow 35.9/144: 25% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:07.774 breath V obliterate Fluffy_Pillow 44.9/144: 31% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:09.118 breath Z howling_blast Fluffy_Pillow 32.9/144: 23% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:10.463 breath U obliterate Fluffy_Pillow 24.9/144: 17% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:11.807 breath Z howling_blast Fluffy_Pillow 28.9/144: 20% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:13.151 single_target l obliterate Fluffy_Pillow 6.8/144: 5% runic_power
5.0/6: 83% rune		 rune_mastery, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:14.496 single_target o obliterate Fluffy_Pillow 37.8/144: 26% runic_power
4.0/6: 67% rune		 rune_mastery, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:15.841 default G antimagic_shell PR_Death_Knight_Frost 62.6/144: 44% runic_power
2.0/6: 33% rune		 gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:16.075 single_target m howling_blast Fluffy_Pillow 62.6/144: 44% runic_power
2.0/6: 33% rune		 antimagic_shell, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:17.420 single_target o obliterate Fluffy_Pillow 78.8/144: 55% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:18.764 single_target r frost_strike Fluffy_Pillow 109.8/144: 76% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_frost
3:20.107 single_target o obliterate Fluffy_Pillow 84.8/144: 59% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_frost
3:21.451 single_target r frost_strike Fluffy_Pillow 114.8/144: 80% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_frost
3:22.795 single_target l obliterate Fluffy_Pillow 89.8/144: 62% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_frost
3:24.140 single_target k remorseless_winter Fluffy_Pillow 109.8/144: 76% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_frost
3:25.484 single_target m howling_blast Fluffy_Pillow 119.8/144: 83% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_frost
3:26.827 single_target n frost_strike Fluffy_Pillow 127.8/144: 89% runic_power
1.0/6: 17% rune		 rune_mastery, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_frost
3:28.171 single_target r frost_strike Fluffy_Pillow 102.8/144: 71% runic_power
1.0/6: 17% rune		 rune_mastery, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_frost
3:29.515 cooldowns h pillar_of_frost Fluffy_Pillow 82.8/144: 57% runic_power
2.0/6: 33% rune		 rune_mastery, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_frost
3:29.515 single_target l obliterate Fluffy_Pillow 82.8/144: 57% runic_power
2.0/6: 33% rune		 rune_mastery, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_frost
3:30.859 single_target m howling_blast Fluffy_Pillow 112.8/144: 78% runic_power
0.0/6: 0% rune		 gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
3:32.204 single_target n frost_strike Fluffy_Pillow 125.8/144: 87% runic_power
1.0/6: 17% rune		 gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
3:33.549 single_target l obliterate Fluffy_Pillow 100.8/144: 70% runic_power
3.0/6: 50% rune		 gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
3:34.895 single_target m howling_blast Fluffy_Pillow 120.8/144: 84% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:36.240 single_target n frost_strike Fluffy_Pillow 130.7/144: 91% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:37.585 single_target o obliterate Fluffy_Pillow 105.7/144: 73% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:38.929 single_target m howling_blast Fluffy_Pillow 136.7/144: 95% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:40.274 single_target n frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:41.619 single_target l obliterate Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:42.964 single_target m howling_blast Fluffy_Pillow 143.8/144: 100% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:44.308 single_target k remorseless_winter Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:45.652 single_target n frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:46.997 single_target n frost_strike Fluffy_Pillow 125.2/144: 87% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:48.342 single_target l obliterate Fluffy_Pillow 100.2/144: 70% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:49.684 single_target m howling_blast Fluffy_Pillow 125.0/144: 87% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:51.028 single_target n frost_strike Fluffy_Pillow 133.0/144: 92% runic_power
2.0/6: 33% rune		 unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:52.374 single_target o obliterate Fluffy_Pillow 108.0/144: 75% runic_power
3.0/6: 50% rune		 unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_frost
3:53.718 single_target m howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_frost
3:55.062 single_target n frost_strike Fluffy_Pillow 136.0/144: 94% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:56.406 single_target o obliterate Fluffy_Pillow 117.2/144: 81% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:57.751 single_target m howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:59.095 single_target l obliterate Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:00.441 trinkets t use_item_dragon_games_equipment Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:00.685 cooldowns f abomination_limb Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, elemental_chaos_fire
4:02.029 cooldowns j raise_dead Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:02.030 single_target m howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:03.374 single_target l obliterate Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:04.719 single_target k remorseless_winter Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:06.063 default H frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
0.0/6: 0% rune		 unholy_strength, abomination_limb, killing_machine, remorseless_winter, bonegrinder_crit(2), elemental_chaos_fire
4:07.408 cooldowns i breath_of_sindragosa Fluffy_Pillow 119.0/144: 83% runic_power
1.0/6: 17% rune		 unholy_strength, abomination_limb, icy_talons, killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy, elemental_chaos_fire
4:07.408 breath S howling_blast Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy, elemental_chaos_fire
4:08.753 breath U obliterate Fluffy_Pillow 116.0/144: 81% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons(2), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(2), elemental_chaos_fire
4:10.098 cooldowns h pillar_of_frost Fluffy_Pillow 125.0/144: 87% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:10.098 breath V obliterate Fluffy_Pillow 125.0/144: 87% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:11.443 breath V obliterate Fluffy_Pillow 112.0/144: 78% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:12.787 breath S howling_blast Fluffy_Pillow 120.8/144: 84% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:14.132 breath U obliterate Fluffy_Pillow 114.7/144: 80% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:15.476 breath S howling_blast Fluffy_Pillow 113.7/144: 79% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:16.822 breath V obliterate Fluffy_Pillow 113.8/144: 79% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:18.166 breath S howling_blast Fluffy_Pillow 122.6/144: 85% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:19.510 default G antimagic_shell PR_Death_Knight_Frost 100.6/144: 70% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:19.510 breath U obliterate Fluffy_Pillow 100.6/144: 70% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:20.855 breath S howling_blast Fluffy_Pillow 115.6/144: 80% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), rime, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:22.199 trinkets s use_item_blazebinders_hoof Fluffy_Pillow 115.7/144: 80% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:22.199 breath Y obliterate Fluffy_Pillow 115.7/144: 80% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_fire
4:23.542 breath S howling_blast Fluffy_Pillow 108.5/144: 75% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
4:24.886 breath R remorseless_winter Fluffy_Pillow 102.4/144: 71% runic_power
5.0/6: 83% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
4:26.229 breath U obliterate Fluffy_Pillow 98.8/144: 69% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
4:27.573 breath V obliterate Fluffy_Pillow 91.6/144: 64% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
4:28.914 breath S howling_blast Fluffy_Pillow 100.4/144: 70% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
4:30.258 breath T horn_of_winter Fluffy_Pillow 100.5/144: 70% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
4:31.601 breath U obliterate Fluffy_Pillow 93.5/144: 65% runic_power
5.0/6: 83% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
4:32.944 breath S howling_blast Fluffy_Pillow 97.5/144: 68% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
4:34.290 breath V obliterate Fluffy_Pillow 89.5/144: 62% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
4:35.636 breath S howling_blast Fluffy_Pillow 82.5/144: 57% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
4:36.981 breath V obliterate Fluffy_Pillow 79.5/144: 55% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_chaos_fire
4:38.325 breath S howling_blast Fluffy_Pillow 88.5/144: 61% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_chaos_fire
4:39.669 breath U obliterate Fluffy_Pillow 69.5/144: 48% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_fire
4:41.014 cooldowns c empower_rune_weapon Fluffy_Pillow 73.5/144: 51% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_fire
4:41.014 breath V obliterate Fluffy_Pillow 78.5/144: 55% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_fire
4:42.184 breath V obliterate Fluffy_Pillow 92.5/144: 64% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_fire
4:43.354 breath S howling_blast Fluffy_Pillow 101.5/144: 70% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
4:44.525 breath V obliterate Fluffy_Pillow 77.5/144: 54% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
4:45.695 Waiting     0.201 sec 81.5/144: 57% runic_power
0.0/6: 0% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
4:45.896 cooldowns h pillar_of_frost Fluffy_Pillow 81.5/144: 57% runic_power
0.0/6: 0% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
4:46.098 breath R remorseless_winter Fluffy_Pillow 86.5/144: 60% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
4:47.269 Waiting     1.130 sec 85.5/144: 59% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
4:48.399 breath V obliterate Fluffy_Pillow 69.5/144: 48% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
4:49.569 breath S howling_blast Fluffy_Pillow 57.5/144: 40% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_fire
4:50.740 breath U obliterate Fluffy_Pillow 54.5/144: 38% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_fire
4:51.909 breath V obliterate Fluffy_Pillow 68.5/144: 48% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:53.081 breath S howling_blast Fluffy_Pillow 77.3/144: 54% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:54.250 breath V obliterate Fluffy_Pillow 71.2/144: 49% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:55.421 breath S howling_blast Fluffy_Pillow 64.0/144: 44% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:56.591 breath U obliterate Fluffy_Pillow 64.2/144: 45% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:57.761 breath U obliterate Fluffy_Pillow 73.0/144: 51% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:58.933 breath S howling_blast Fluffy_Pillow 81.8/144: 57% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5770 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 9.52% 3.34% 685
Attack Power 6058 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa)
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

actions.trinkets=use_item,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 45926 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45926.0 45926.0 45.5 / 0.099% 7487.0 / 16.3% 2602.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.9 Runic Power 2.50% 54.2 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 45926
Apocalypse 211 0.5% 6.9 45.71sec 9128 7201 Direct 6.9 7856 15779 9128 16.1%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 0.00 1.2675 0.0000 63322.40 63322.40 0.00% 7201.46 7201.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.95% 5.82 1 8 7855.73 6078 10950 7849.60 6819 8745 45750 45750 0.00%
crit 16.05% 1.11 0 5 15779.12 12399 21234 10961.07 0 20892 17572 17572 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    garg_setup
    [T]:6.94
  • if_expr:buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
auto_attack_mh 2780 6.1% 153.6 2.35sec 5426 2322 Direct 153.6 4662 9374 5426 16.2%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.64 153.64 0.00 0.00 0.00 2.3372 0.0000 833664.03 1190978.99 30.00% 2321.60 2321.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 128.73 87 171 4662.14 3725 6659 4661.53 4425 4929 600140 857365 30.00%
crit 16.22% 24.91 6 51 9373.73 7451 13139 9372.29 8439 10327 233524 333614 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 191 0.4% 7.0 45.86sec 8230 6493 Direct 7.0 7053 14179 8230 16.5%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 1.2675 0.0000 57421.22 57421.22 0.00% 6493.41 6493.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.48% 5.82 1 8 7053.35 5438 9796 7046.24 6151 7999 41082 41082 0.00%
crit 16.52% 1.15 0 6 14178.53 11963 18971 10075.90 0 18971 16340 16340 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [P]:4.73
  • if_expr:variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
    garg_setup
    [X]:2.25
  • if_expr:talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
Death Coil 4603 (5961) 10.0% (13.0%) 99.3 2.99sec 17974 15549 Direct 99.3 (234.5) 11928 23971 13886 16.3% (16.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.32 99.27 0.00 0.00 0.00 1.1560 0.0000 1378457.73 1378457.73 0.00% 15548.60 15548.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.74% 83.13 57 111 11927.59 7432 19976 11937.43 11206 12895 991555 991555 0.00%
crit 16.26% 16.14 4 33 23971.20 15162 38983 23988.28 20058 30205 386902 386902 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    default
    [G]:4.79
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
    garg_setup
    [Z]:1.30
  • if_expr:rune<=1
    generic
    [b]:93.22
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
    Coil of Devastation 1358 3.0% 0.0 0.00sec 0 0 Periodic 135.3 3006 0 3006 0.0% 90.2%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 135.25 135.25 84.52 0.0000 2.0000 406630.36 406630.36 0.00% 1503.20 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 135.25 104 168 3006.43 1115 12976 3012.38 2539 3634 406630 406630 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 900 2.0% 6.9 46.83sec 39142 0 Direct 6.9 33622 67587 39172 16.3%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.00 0.0000 0.0000 270210.71 386025.14 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.66% 5.77 0 9 33622.04 33373 34365 33612.83 0 34365 194034 277198 29.99%
crit 16.34% 1.13 0 6 67587.16 66746 68730 47049.10 0 68730 76177 108827 20.88%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1109 2.4% 26.2 11.08sec 12685 10518 Direct 26.2 10892 21900 12685 16.3%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.22 26.22 0.00 0.00 0.00 1.2060 0.0000 332581.59 475128.67 30.00% 10518.41 10518.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 21.95 13 35 10892.28 8211 17348 10886.47 9864 11819 239082 341554 30.00%
crit 16.28% 4.27 0 15 21899.97 16421 35734 21628.15 0 29886 93500 133574 29.64%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [Y]:2.23
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
  • target_if_expr:debuff.festering_wound.stack
    generic
    [d]:23.99
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1796 3.9% 105.7 3.46sec 5092 0 Direct 105.7 4376 8792 5092 16.2%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.74 105.74 0.00 0.00 0.00 0.0000 0.0000 538457.21 538457.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 88.59 59 121 4375.67 3020 7607 4376.42 4091 4697 387646 387646 0.00%
crit 16.22% 17.15 5 33 8791.93 6039 15161 8791.71 7460 10938 150811 150811 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 78 0.2% 11.6 27.04sec 2023 1723 Direct 11.6 1739 3484 2023 16.3%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.1744 0.0000 23521.33 23521.33 0.00% 1723.05 1723.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.69% 9.73 3 14 1738.84 1216 2937 1739.03 1450 1984 16917 16917 0.00%
crit 16.31% 1.90 0 8 3483.96 2431 5874 3052.95 0 5874 6605 6605 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [H]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
Scourge Strike 995 (2318) 2.2% (5.1%) 79.0 3.70sec 8796 7731 Direct 79.0 (158.1) 3245 6526 3776 16.2% (16.2%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 79.03 79.03 0.00 0.00 0.00 1.1378 0.0000 298433.42 426344.33 30.00% 7730.60 7730.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.81% 66.23 43 91 3245.28 2381 5108 3244.84 3039 3450 214944 307071 30.00%
crit 16.19% 12.79 1 28 6526.47 4763 10269 6528.01 5554 8609 83489 119273 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    garg_setup
    [a]:1.36
  • if_expr:debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse
  • target_if_expr:debuff.festering_wound.stack
    generic
    [c]:77.66
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 1323 2.9% 0.0 0.00sec 0 0 Direct 79.0 4316 8663 5020 16.2%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 79.03 0.00 0.00 0.00 0.0000 0.0000 396678.71 396678.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 66.23 40 89 4315.61 2704 7166 4317.70 4016 4667 285806 285806 0.00%
crit 16.20% 12.80 2 28 8662.52 5845 14131 8664.43 6630 11293 110873 110873 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 482 (2793) 1.1% (6.1%) 15.6 6.91sec 53764 44067 Direct 15.6 (31.1) 7981 16034 9285 16.2% (16.2%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.56 15.56 0.00 0.00 0.00 1.2201 0.0000 144480.35 144480.35 0.00% 44067.01 44067.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 13.04 6 20 7980.63 5001 12051 7992.92 7043 8861 104060 104060 0.00%
crit 16.20% 2.52 0 10 16033.74 10002 24186 14907.85 0 22869 40420 40420 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [S]:15.19
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
    garg_setup
    [U]:0.37
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
    Soul Reaper (_execute) 2311 5.0% 15.6 6.91sec 44505 0 Direct 15.6 38268 76828 44505 16.2%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.55 15.55 0.00 0.00 0.00 0.0000 0.0000 692087.72 692087.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.82% 13.04 6 19 38267.62 27448 55677 38314.63 34078 43629 498834 498834 0.00%
crit 16.18% 2.52 0 9 76828.09 58567 110201 71676.02 0 108651 193254 193254 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 197 0.4% 3.6 91.66sec 16220 14093 Direct 3.6 13910 27974 16219 16.4%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1512 0.0000 59104.34 59104.34 0.00% 14092.60 14092.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.57% 3.05 0 4 13909.55 11318 16955 13888.64 0 16955 42358 42358 0.00%
crit 16.43% 0.60 0 4 27974.48 22636 33911 13445.09 0 33911 16746 16746 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [R]:3.64
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
Unholy Pact 1271 2.8% 122.7 2.65sec 3105 0 Direct 122.7 2667 5357 3104 16.2%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.74 122.74 0.00 0.00 0.00 0.0000 0.0000 381037.19 381037.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.75% 102.79 69 133 2667.49 1819 4354 2668.08 2450 2876 274201 274201 0.00%
crit 16.25% 19.94 4 38 5357.07 3711 8662 5359.08 4532 6403 106836 106836 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 840 1.8% 11.6 27.04sec 21669 0 Periodic 99.5 2174 4367 2532 16.3% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.49 99.49 10.60 0.0000 3.0000 251888.90 251888.90 0.00% 843.91 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.70% 83.28 56 111 2174.25 1520 3828 2174.47 2057 2304 181063 181063 0.00%
crit 16.30% 16.22 4 34 4367.31 3131 7551 4368.72 3817 5303 70826 70826 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 5760 / 5760
Claw 297 0.7% 37.9 7.83sec 2351 2341 Direct 37.9 2026 4044 2351 16.1%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.93 37.93 0.00 0.00 0.00 1.0045 0.0000 89197.76 127428.62 30.00% 2340.90 2340.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.87% 31.82 16 47 2025.86 1654 6667 2024.23 1837 2183 64456 92082 30.00%
crit 16.13% 6.12 0 16 4044.46 3308 12144 4035.17 0 5502 24742 35347 29.95%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.93
  • if_expr:energy>70
Gnaw 0 0.0% 0.3 90.14sec 81 81 Direct 0.3 69 138 81 17.1%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.33 0.33 0.00 0.00 0.00 1.0078 0.0000 26.44 37.78 30.00% 80.62 80.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.94% 0.27 0 3 69.38 58 85 13.55 0 85 19 27 5.87%
crit 17.06% 0.06 0 2 138.11 117 164 7.27 0 164 8 11 1.58%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:0.33
main_hand 4118 9.0% 193.3 1.54sec 6376 4139 Direct 193.3 5488 10959 6376 16.2%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.26 193.26 0.00 0.00 0.00 1.5404 0.0000 1232181.81 1760304.61 30.00% 4139.02 4139.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.77% 161.90 115 210 5487.71 1838 12800 5497.60 4867 6222 888436 1269226 30.00%
crit 16.23% 31.37 13 60 10959.47 3676 25256 10985.39 6991 14985 343746 491078 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 30 0.1% 3.3 91.19sec 2711 2700 Direct 3.3 2333 4668 2711 16.2%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.35 3.35 0.00 0.00 0.00 1.0045 0.0000 9070.66 12958.42 30.00% 2699.60 2699.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.81% 2.80 0 4 2333.41 1842 3001 2322.96 0 2970 6543 9347 29.79%
crit 16.19% 0.54 0 4 4668.10 3685 5939 2051.39 0 5939 2528 3612 13.18%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:3.35
Sweeping Claws 1315 2.9% 68.9 4.25sec 5712 5686 Direct 68.9 4920 9825 5712 16.1%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.86 68.86 0.00 0.00 0.00 1.0045 0.0000 393287.52 393287.52 0.00% 5686.06 5686.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.85% 57.74 38 76 4919.67 3545 8229 4922.58 4517 5329 284059 284059 0.00%
crit 16.15% 11.12 2 23 9824.62 7090 16458 9834.34 7272 12718 109228 109228 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:68.86
pet - gargoyle 31404 / 5301
Gargoyle Strike 31404 11.4% 40.4 5.16sec 38845 36434 Direct 40.4 33466 66669 38845 16.2%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.42 40.42 0.00 0.00 0.00 1.0662 0.0000 1570203.73 1570203.73 0.00% 36434.18 36434.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 33.87 22 41 33465.70 5674 74913 33460.79 27418 40420 1133577 1133577 0.00%
crit 16.20% 6.55 0 18 66668.94 11685 152003 66642.18 0 121677 436627 436627 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:42.42
pet - risen_skulker 1130 / 1130
Skulker Shot 1130 2.5% 155.2 1.92sec 2183 1133 Direct 155.1 1880 3755 2184 16.2%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.19 155.13 0.00 0.00 0.00 1.9266 0.0000 338729.55 483911.70 30.00% 1132.95 1132.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.81% 130.01 91 167 1879.86 1395 3238 1880.74 1772 1997 244395 349144 30.00%
crit 16.19% 25.12 8 47 3755.17 2789 6475 3757.68 3293 4421 94335 134767 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:156.19
pet - army_ghoul 24449 / 5408
Claw 3983 1.9% 215.2 1.00sec 1212 1212 Direct 215.2 1043 2083 1212 16.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 215.24 215.24 0.00 0.00 0.00 1.0000 0.0000 260857.25 372662.72 30.00% 1211.91 1211.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 180.20 143 198 1042.50 482 1511 1042.28 866 1130 187857 268374 30.00%
crit 16.28% 35.05 18 62 2082.91 964 3023 2083.66 1682 2386 73000 104288 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.85
    default
    [ ]:26.85
    default
    [ ]:26.90
    default
    [ ]:26.92
    default
    [ ]:26.92
    default
    [ ]:26.93
    default
    [ ]:26.93
    default
    [ ]:26.94
main_hand 20467 9.8% 353.7 0.60sec 3791 3418 Direct 353.7 3262 6519 3791 16.2%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 353.65 353.65 0.00 0.00 0.00 1.1089 0.0000 1340560.83 1915135.73 30.00% 3418.21 3418.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.77% 296.24 239 331 3261.94 1443 4523 3261.62 2654 3546 966332 1380509 30.00%
crit 16.23% 57.41 30 92 6518.51 2886 9046 6521.19 5067 7353 374229 534626 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - magus_of_the_dead 7790 / 3981
Frostbolt 2269 2.5% 41.6 7.11sec 8320 5822 Direct 41.6 7161 14313 8323 16.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.63 41.62 0.00 0.00 0.00 1.4292 0.0000 346378.39 346378.39 0.00% 5821.58 5821.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.76% 34.86 22 47 7161.41 3694 11419 7164.55 6474 8015 249654 249654 0.00%
crit 16.24% 6.76 0 16 14313.47 7387 22839 14307.05 0 20662 96724 96724 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:22.58
    default
    [ ]:22.19
Shadow Bolt 5521 6.1% 99.5 2.92sec 8449 6597 Direct 99.4 7272 14528 8451 16.2%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.47 99.45 0.00 0.00 0.00 1.2807 0.0000 840424.34 840424.34 0.00% 6597.05 6597.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.75% 83.29 63 104 7271.68 3474 10886 7274.67 6424 7955 605647 605647 0.00%
crit 16.25% 16.16 4 30 14528.03 6947 21696 14538.07 11470 17950 234778 234778 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:53.01
    default
    [ ]:52.27
pet - apoc_ghoul 8687 / 3901
Claw 1623 1.6% 197.3 1.43sec 1106 1106 Direct 197.3 951 1902 1106 16.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 197.34 197.34 0.00 0.00 0.00 1.0000 0.0000 218168.59 311677.35 30.00% 1105.54 1105.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 165.34 114 221 951.30 578 1511 952.35 839 1031 157286 224700 30.00%
crit 16.22% 32.00 11 59 1902.31 1178 3012 1904.82 1637 2220 60882 86977 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:49.33
    default
    [ ]:49.45
    default
    [ ]:49.38
    default
    [ ]:49.19
main_hand 7064 6.9% 279.5 1.01sec 3399 2464 Direct 279.5 2926 5845 3399 16.2%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 279.45 279.45 0.00 0.00 0.00 1.3794 0.0000 949777.81 1356860.04 30.00% 2463.95 2463.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 234.18 163 303 2925.76 1762 4523 2929.64 2583 3194 685150 978811 30.00%
crit 16.20% 45.27 19 76 5844.94 3524 9046 5854.70 4870 6963 264628 378049 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 183.86sec

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.1361 1.1361 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Anti-Magic Shell 7.0 45.12sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.97 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [E]:6.97
  • if_expr:(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6575 0.4688 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [F]:1.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 183.93sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [e]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 167.98sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [Q]:2.41
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 306.89sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [O]:0.49
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
    garg_setup
    [W]:1.00
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Summon Gargoyle 2.0 183.59sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    garg_setup
    [V]:2.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
Unholy Strength 21.6 13.58sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.57 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 184.2sec 184.2sec 20.0sec 13.52% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:181.3s / 204.1s
  • trigger_min/max:181.3s / 204.1s
  • trigger_pct:100.00%
  • duration_min/max:20.0s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.52%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.0 0.0 45.2sec 45.2sec 6.9sec 16.11% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 106.9s
  • trigger_min/max:40.0s / 106.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:16.11%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 183.9sec 183.9sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 199.4s
  • trigger_min/max:180.0s / 199.4s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dark Transformation 7.0 0.0 45.9sec 45.9sec 22.5sec 52.31% 59.03% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 66.7s
  • trigger_min/max:45.0s / 66.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.0s

Stack Uptimes

  • dark_transformation_1:52.31%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.0sec 120.0sec 0.7sec 0.64% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.62
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 121.1s
  • trigger_min/max:120.0s / 121.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.64%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.6sec 99.2sec 57.9sec 25.02% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 335.7s

Stack Uptimes

  • elemental_chaos_air_1:25.02%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.3sec 99.8sec 57.8sec 25.32% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:25.32%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.6sec 100.8sec 58.0sec 24.68% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:24.68%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 122.9sec 97.6sec 58.1sec 24.97% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 328.9s

Stack Uptimes

  • elemental_chaos_frost_1:24.97%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.8sec 306.8sec 27.4sec 13.32% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 330.2s
  • trigger_min/max:300.0s / 330.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.32%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.0sec 168.0sec 19.3sec 15.42% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 205.1s
  • trigger_min/max:120.0s / 205.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.42%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Festermight 13.2 72.0 23.3sec 3.5sec 19.3sec 84.66% 0.00% 0.0 (0.0) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 50.1s
  • trigger_min/max:0.8s / 32.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:7.56%
  • festermight_2:8.69%
  • festermight_3:9.77%
  • festermight_4:14.51%
  • festermight_5:10.53%
  • festermight_6:8.35%
  • festermight_7:7.28%
  • festermight_8:6.11%
  • festermight_9:4.53%
  • festermight_10:3.26%
  • festermight_11:1.96%
  • festermight_12:1.09%
  • festermight_13:0.61%
  • festermight_14:0.33%
  • festermight_15:0.08%
  • festermight_16:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 99.3 144.8sec 3.0sec 289.0sec 99.97% 90.22% 97.2 (97.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:44.8s / 332.5s
  • trigger_min/max:0.8s / 19.2s
  • trigger_pct:100.00%
  • duration_min/max:4.7s / 360.0s

Stack Uptimes

  • icy_talons_1:1.35%
  • icy_talons_2:0.38%
  • icy_talons_3:98.24%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 12.0 8.2 24.8sec 14.4sec 10.7sec 42.61% 0.00% 8.2 (8.2) 11.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 177.2s
  • trigger_min/max:0.8s / 177.2s
  • trigger_pct:14.99%
  • duration_min/max:0.0s / 71.7s

Stack Uptimes

  • rune_mastery_1:42.61%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 41.7 6.0 7.1sec 6.2sec 2.6sec 36.24% 0.00% 6.0 (6.0) 41.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 76.9s
  • trigger_min/max:0.8s / 76.9s
  • trigger_pct:47.53%
  • duration_min/max:0.0s / 21.0s

Stack Uptimes

  • runic_corruption_1:36.24%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 20.9 0.2 14.0sec 13.8sec 1.0sec 6.98% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.3s / 54.8s
  • trigger_min/max:1.3s / 54.8s
  • trigger_pct:14.17%
  • duration_min/max:0.0s / 9.3s

Stack Uptimes

  • sudden_doom_1:6.98%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7sec 91.7sec 19.6sec 23.79% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 114.6s
  • trigger_min/max:90.0s / 114.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.79%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.9sec 45.9sec 14.7sec 34.21% 37.36% 95.8 (95.8) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 66.7s
  • trigger_min/max:45.0s / 66.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.21%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 13.1 36.1sec 13.6sec 24.5sec 69.12% 0.00% 13.1 (13.1) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 174.1s
  • trigger_min/max:0.0s / 57.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 157.5s

Stack Uptimes

  • unholy_strength_1:69.12%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.9sec 45.9sec 19.5sec 99.93% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 135.8s
  • trigger_min/max:45.0s / 135.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.93%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.8sec 45.8sec 19.5sec 99.93% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 138.8s
  • trigger_min/max:45.0s / 138.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.93%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.9sec 45.9sec 19.5sec 99.93% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 135.8s
  • trigger_min/max:45.0s / 135.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.93%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.8 0.0 46.0sec 46.0sec 19.5sec 99.94% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 135.8s
  • trigger_min/max:45.0s / 135.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.9sec 184.9sec 27.4sec 90.07% 95.99% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.6s / 230.9s
  • trigger_min/max:181.6s / 230.9s
  • trigger_pct:100.00%
  • duration_min/max:11.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.07%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.7sec 184.7sec 27.5sec 89.91% 96.55% 0.0 (0.0) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.1s / 230.4s
  • trigger_min/max:181.1s / 230.4s
  • trigger_pct:100.00%
  • duration_min/max:11.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:89.91%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.4sec 184.4sec 27.7sec 89.66% 96.57% 0.0 (0.0) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 229.9s
  • trigger_min/max:180.6s / 229.9s
  • trigger_pct:100.00%
  • duration_min/max:10.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:89.66%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.2sec 184.2sec 27.8sec 90.62% 97.56% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 233.3s
  • trigger_min/max:180.6s / 233.3s
  • trigger_pct:100.00%
  • duration_min/max:10.4s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.62%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.1sec 184.1sec 27.9sec 90.82% 97.48% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 232.8s
  • trigger_min/max:180.6s / 232.8s
  • trigger_pct:100.00%
  • duration_min/max:9.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.82%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.0sec 184.0sec 28.0sec 90.99% 97.36% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 232.3s
  • trigger_min/max:180.6s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:9.4s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.99%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.1sec 184.1sec 28.0sec 93.02% 98.88% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 231.8s
  • trigger_min/max:180.6s / 231.8s
  • trigger_pct:100.00%
  • duration_min/max:8.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:93.02%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.0sec 184.0sec 28.0sec 93.08% 98.71% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 231.3s
  • trigger_min/max:180.6s / 231.3s
  • trigger_pct:100.00%
  • duration_min/max:8.4s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:93.08%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 183.6sec 183.6sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 203.3s
  • trigger_min/max:180.6s / 203.3s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.0sec 184.0sec 23.8sec 95.15% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 203.6s
  • trigger_min/max:180.9s / 203.6s
  • trigger_pct:100.00%
  • duration_min/max:17.1s / 24.0s

Stack Uptimes

  • dark_empowerment_1:95.15%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.4 0.0 66.5sec 66.5sec 20.8sec 97.68% 98.60% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.9s / 228.7s
  • trigger_min/max:41.9s / 228.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.68%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.5 0.0 65.4sec 65.4sec 20.9sec 97.64% 98.58% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.5s / 229.0s
  • trigger_min/max:41.5s / 229.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.64%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.6 8.0 47.0 11.5s 1.3s 140.2s
Rune ready 158.1 120.0 199.0 2.0s 0.0s 12.6s
Runic Corruption from Runic Power Spent 47.7 24.0 75.0 6.2s 0.8s 76.9s
Festering Wound from Festering Strike 65.6 43.0 90.0 11.1s 1.0s 60.2s
Festering Wound from Infected Claws 32.0 15.0 58.0 9.3s 1.0s 102.6s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.7s 90.0s 114.6s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.29% 0.00% 17.61% 2.0s 0.0s 21.2s
ghoul - Energy Cap 0.53% 0.18% 1.70% 0.2s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=310672)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0971.965 / 1.0887.28523.385
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
28.78658.01981.396 / 80.150109.123146.021

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead6.1330.00142.4925.9920.00042.492
Anti-Magic Shell6.7110.00166.93730.83118.48098.544
Summon Gargoyle3.6340.57423.2713.6340.57423.271
Dark Transformation0.9400.00121.6925.1680.94524.026
Apocalypse0.8960.00121.7784.2740.18322.961
Empower Rune Weapon49.4030.00185.06567.74760.53393.951
Unholy Assault1.6920.00124.5534.4270.52725.065
Soul Reaper1.0070.00113.26913.2914.52627.924

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.8713.688.65%0.990.201.43%
Empower Rune WeaponRunic Power11.5556.342.37%4.881.402.42%
Empower Rune WeaponRune11.5511.087.00%0.960.474.08%
Festering WoundRunic Power105.74308.9713.00%2.928.262.60%
Rune RegenerationRune133.38133.3884.35%1.000.000.00%
Runic AttenuationRunic Power74.76362.4915.25%4.8511.313.03%
Army of the DeadRunic Power2.0019.860.84%9.930.140.72%
Festering StrikeRunic Power26.22508.7221.40%19.4015.662.99%
OutbreakRunic Power11.62113.194.76%9.743.062.63%
Scourge StrikeRunic Power79.02775.4732.62%9.8114.781.87%
Soul ReaperRunic Power15.56147.166.19%9.468.445.42%
Summon GargoyleRunic Power2.0085.123.58%42.5614.8814.88%
pet - ghoul
Dark TransformationEnergy6.98365.038.68%52.32332.6547.68%
energy_regenEnergy1349.173839.8891.32%2.8557.651.48%
pet - army_ghoul
energy_regenEnergy902.377177.64100.00%7.95965.6411.86%
pet - apoc_ghoul
energy_regenEnergy708.645677.79100.00%8.011721.0223.26%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Death CoilRunic Power 99.322353.0623.6923.69758.62
Festering StrikeRune 26.2252.442.002.006342.40
OutbreakRune 11.6211.621.001.002023.41
Scourge StrikeRune 79.0279.021.001.008796.11
Soul ReaperRune 15.5615.561.001.0053763.35
pet - ghoul
ClawEnergy 37.931517.3540.0040.0058.79
Sweeping ClawsEnergy 68.862754.3040.0040.00142.79
pet - army_ghoul
ClawEnergy 215.258609.8140.0040.0030.30
pet - apoc_ghoul
ClawEnergy 197.347893.7340.0040.0027.64
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 8.0 7.92 7.85 77.9 22.3 0.0 85.0
Rune 5.0 0.53 0.54 0.0 3.5 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 45925.99
Minimum 40980.87
Maximum 52684.80
Spread ( max - min ) 11703.93
Range [ ( max - min ) / 2 * 100% ] 12.74%
Standard Deviation 2011.3156
5th Percentile 43025.02
95th Percentile 49530.57
( 95th Percentile - 5th Percentile ) 6505.54
Mean Distribution
Standard Deviation 23.2262
95.00% Confidence Interval ( 45880.47 - 45971.51 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7368
0.1 Scale Factor Error with Delta=300 34534
0.05 Scale Factor Error with Delta=300 138136
0.01 Scale Factor Error with Delta=300 3453378
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 45925.99
Minimum 40980.87
Maximum 52684.80
Spread ( max - min ) 11703.93
Range [ ( max - min ) / 2 * 100% ] 12.74%
Standard Deviation 2011.3156
5th Percentile 43025.02
95th Percentile 49530.57
( 95th Percentile - 5th Percentile ) 6505.54
Mean Distribution
Standard Deviation 23.2262
95.00% Confidence Interval ( 45880.47 - 45971.51 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7368
0.1 Scale Factor Error with Delta=300 34534
0.05 Scale Factor Error with Delta=300 138136
0.01 Scale Factor Error with Delta=300 3453378
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 45925.99
Minimum 40980.87
Maximum 52684.80
Spread ( max - min ) 11703.93
Range [ ( max - min ) / 2 * 100% ] 12.74%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 6127977.23
Minimum 4673846.58
Maximum 7640430.73
Spread ( max - min ) 2966584.16
Range [ ( max - min ) / 2 * 100% ] 24.21%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
D 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
E 6.97 antimagic_shell,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
0.00 variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle
Variables
0.00 variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4)|fight_remains<10
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&cooldown.apocalypse.remains|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration)|fight_remains<=21
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
F 1.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
Prioritize Army, Outbreak and Maintaining Plaguebringer
0.00 wait_for_cooldown,name=apocalypse,if=cooldown.apocalypse.remains<gcd&buff.commander_of_the_dead_window.up
G 4.79 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 unholy_blight,if=!buff.commander_of_the_dead_window.up&(variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21)
H 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
0.00 wound_spender,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
I 0.00 run_action_list,name=garg_setup,if=variable.garg_setup=0
Call Action Lists
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=trinkets
L 0.00 call_action_list,name=racials
M 0.00 run_action_list,name=aoe,if=active_enemies>=4
N 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
O 0.49 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 summon_gargoyle,if=active_enemies>=3
0.00 abomination_limb,if=rune<2&variable.adds_remain
0.00 raise_dead,if=!pet.ghoul.active
P 4.73 dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
0.00 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
0.00 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead|cooldown.dark_transformation.remains>30)
0.00 apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
Q 2.41 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
0.00 abomination_limb,if=rune<3&variable.st_planning
R 3.64 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
0.00 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.adds_remain&debuff.festering_wound.stack<2
S 15.19 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.garg_setup
# count action,conditions
T 6.94 apocalypse,if=buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
Garg Setup
0.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
U 0.37 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
V 2.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
W 1.00 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
X 2.25 dark_transformation,if=talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
Y 2.23 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
Z 1.30 death_coil,if=rune<=1
a 1.36 wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse
actions.generic
# count action,conditions
b 93.22 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
Generic
0.00 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground)&death_knight.fwounded_targets=active_enemies
c 77.66 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
d 23.99 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
e 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
f 2.00 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
g 2.77 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

012456789ABCDHWYYXVGGTQRfbbEbccbccebcbccbbHdbcbbccbcdbgcccbdbcbccbdbdbHcEPTGccbcbbdcbcbcbdbHbcbccbbdbEdbcPTRccGHccbccbcdbbbccbbdbccbcHbEdbdbPTcdbcbgccbcHbcbcdbbccbdbccbccbdbHFXVGTQRfSbbEbbcSebcbcbcSbccbbHSbccdSbbbcSbbdcSbPaTEHScGbdSbcbcSbbcbScbccHSbbdgbSdbdEbPaTRScbbccSHbbbbSbbccc

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 5 army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 elemental_chaos_frost
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
Pre precombat C trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
0:00.000 default D auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 icy_talons, elemental_chaos_frost
0:00.000 default H outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, icy_talons, elemental_chaos_frost
0:01.021 garg_setup W potion Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, icy_talons, elemental_chaos_frost
0:01.021 garg_setup Y festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, icy_talons, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:02.041 garg_setup Y festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 bloodlust, icy_talons, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.060 garg_setup X dark_transformation Fluffy_Pillow 63.0/100: 63% runic_power
0.0/6: 0% rune		 bloodlust, icy_talons, sudden_doom, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.060 garg_setup V summon_gargoyle Fluffy_Pillow 63.0/100: 63% runic_power
0.0/6: 0% rune		 bloodlust, icy_talons, dark_transformation, sudden_doom, unholy_pact, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:04.082 default G death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 bloodlust, icy_talons, dark_transformation, sudden_doom, unholy_pact, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.103 default G death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 bloodlust, icy_talons(2), dark_transformation, unholy_pact, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.123 garg_setup T apocalypse Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 bloodlust, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.144 cooldowns Q empower_rune_weapon Fluffy_Pillow 82.0/100: 82% runic_power
4.0/6: 67% rune		 bloodlust, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.144 cooldowns R unholy_assault Fluffy_Pillow 87.0/100: 87% runic_power
5.0/6: 83% rune		 bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.144 trinkets f use_item_algethar_puzzle_box Fluffy_Pillow 87.0/100: 87% runic_power
5.0/6: 83% rune		 bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.130 generic b death_coil Fluffy_Pillow 87.0/100: 87% runic_power
5.0/6: 83% rune		 bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.884 generic b death_coil Fluffy_Pillow 62.0/100: 62% runic_power
5.0/6: 83% rune		 bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.637 default E antimagic_shell PR_Death_Knight_Unholy 32.0/100: 32% runic_power
6.0/6: 100% rune		 bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.637 generic b death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.392 generic c scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.146 generic c scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.900 generic b death_coil Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.654 generic c scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.408 generic c scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.160 racials e berserking Fluffy_Pillow 39.0/100: 39% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.160 generic b death_coil Fluffy_Pillow 39.0/100: 39% runic_power
4.0/6: 67% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.914 generic c scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
4.0/6: 67% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.668 generic b death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.422 generic c scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.178 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(10), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.933 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(11), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.687 generic b death_coil Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.440 default H outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.198 generic d festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.951 generic b death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.706 generic c scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.462 generic b death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.216 generic b death_coil Fluffy_Pillow 36.0/100: 36% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.970 generic c scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.726 generic c scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.483 generic b death_coil Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.238 generic c scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.992 generic d festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight, algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.747 generic b death_coil Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.185 trinkets g use_item_dragon_games_equipment Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.767 generic c scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, dragon_games_equipment, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.788 generic c scourge_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.808 generic c scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:31.829 generic b death_coil Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), elemental_chaos_frost
0:32.850 generic d festering_strike Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), elemental_chaos_frost
0:33.870 generic b death_coil Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), elemental_chaos_frost
0:34.891 generic c scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight(4), elemental_chaos_frost
0:35.911 generic b death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, icy_talons(3), festermight(5), elemental_chaos_frost
0:36.932 generic c scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune		 bloodlust, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_frost
0:37.951 generic c scourge_strike Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 bloodlust, icy_talons(3), festermight(6), elemental_chaos_frost
0:38.973 generic b death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune		 bloodlust, icy_talons(3), festermight(7), elemental_chaos_frost
0:39.992 generic d festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 bloodlust, icy_talons(3), festermight(7), elemental_chaos_frost
0:41.013 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(7), elemental_chaos_frost
0:42.339 generic d festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(7), elemental_chaos_frost
0:43.666 generic b death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(7), elemental_chaos_frost
0:44.990 Waiting     1.005 sec 8.0/100: 8% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(7), elemental_chaos_frost
0:45.995 default H outbreak Fluffy_Pillow 8.0/100: 8% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(7), elemental_chaos_frost
0:47.321 Waiting     1.103 sec 23.0/100: 23% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), elemental_chaos_frost
0:48.424 generic c scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), elemental_chaos_frost
0:49.750 default E antimagic_shell PR_Death_Knight_Unholy 41.0/100: 41% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight, elemental_chaos_frost
0:49.750 cooldowns P dark_transformation Fluffy_Pillow 41.0/100: 41% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), festermight, elemental_chaos_frost
0:51.075 garg_setup T apocalypse Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight, elemental_chaos_frost
0:52.448 default G death_coil Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(5), elemental_chaos_frost
0:53.775 generic c scourge_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_frost
0:55.101 generic c scourge_strike Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), elemental_chaos_frost
0:56.426 generic b death_coil Fluffy_Pillow 89.0/100: 89% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_frost
0:57.751 generic c scourge_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_frost
0:59.078 generic b death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_frost
1:00.404 generic b death_coil Fluffy_Pillow 47.0/100: 47% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_pact, festermight(8), elemental_chaos_fire
1:01.729 generic d festering_strike Fluffy_Pillow 47.0/100: 47% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_fire
1:03.055 generic c scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_fire
1:04.381 generic b death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(9), elemental_chaos_fire
1:05.707 generic c scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), elemental_chaos_fire
1:07.032 generic b death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(10), elemental_chaos_fire
1:08.356 generic c scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, sudden_doom, festermight(10), elemental_chaos_fire
1:09.680 generic b death_coil Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, elemental_chaos_fire
1:11.006 generic d festering_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, elemental_chaos_fire
1:12.332 generic b death_coil Fluffy_Pillow 71.0/100: 71% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_fire
1:13.658 default H outbreak Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_fire
1:14.983 generic b death_coil Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_fire
1:16.310 generic c scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_fire
1:17.637 generic b death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_chaos_fire
1:18.962 generic c scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_chaos_fire
1:20.287 generic c scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), elemental_chaos_fire
1:21.611 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:22.938 Waiting     1.230 sec 15.0/100: 15% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:24.168 generic b death_coil Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(3), elemental_chaos_fire
1:25.493 Waiting     0.089 sec 20.0/100: 20% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:25.582 generic d festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:26.909 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:28.237 Waiting     1.291 sec 15.0/100: 15% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:29.528 default E antimagic_shell PR_Death_Knight_Unholy 20.0/100: 20% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:29.750 generic d festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:31.075 generic b death_coil Fluffy_Pillow 40.0/100: 40% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
1:32.400 Waiting     0.388 sec 15.0/100: 15% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_fire
1:32.788 generic c scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_fire
1:34.114 Waiting     0.469 sec 28.0/100: 28% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
1:34.583 cooldowns P dark_transformation Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
1:36.077 garg_setup T apocalypse Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_fire
1:37.447 cooldowns R unholy_assault Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_fire
1:38.773 generic c scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, elemental_chaos_fire
1:39.878 generic c scourge_strike Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, elemental_chaos_fire
1:40.983 default G death_coil Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), elemental_chaos_fire
1:42.088 default H outbreak Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(2), elemental_chaos_fire
1:43.195 generic c scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), elemental_chaos_fire
1:44.300 generic c scourge_strike Fluffy_Pillow 79.0/100: 79% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(3), elemental_chaos_fire
1:45.405 generic b death_coil Fluffy_Pillow 92.0/100: 92% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_fire
1:46.510 generic c scourge_strike Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), elemental_chaos_fire
1:47.615 generic c scourge_strike Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), elemental_chaos_fire
1:48.720 generic b death_coil Fluffy_Pillow 88.0/100: 88% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_fire
1:49.825 generic c scourge_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), elemental_chaos_fire
1:50.931 generic d festering_strike Fluffy_Pillow 71.0/100: 71% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), elemental_chaos_fire
1:52.037 generic b death_coil Fluffy_Pillow 96.0/100: 96% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), elemental_chaos_fire
1:53.144 generic b death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), elemental_chaos_fire
1:54.249 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), elemental_chaos_fire
1:55.353 generic c scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), elemental_chaos_fire
1:56.458 generic c scourge_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(8), elemental_chaos_fire
1:57.562 generic b death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(9), elemental_chaos_fire
1:58.889 generic b death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_fire
2:00.213 generic d festering_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_air
2:01.497 generic b death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_air
2:02.780 generic c scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_air
2:04.063 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, elemental_chaos_air
2:05.347 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
2:06.628 generic c scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
2:07.909 default H outbreak Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
2:09.190 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
2:10.472 default E antimagic_shell PR_Death_Knight_Unholy 11.0/100: 11% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
2:10.472 Waiting     2.946 sec 11.0/100: 11% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
2:13.418 generic d festering_strike Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
2:14.700 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
2:15.983 Waiting     1.073 sec 11.0/100: 11% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_air
2:17.056 generic d festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_air
2:18.339 generic b death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune		 icy_talons(3), festermight(3), elemental_chaos_air
2:19.620 cooldowns P dark_transformation Fluffy_Pillow 1.0/100: 1% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_air
2:21.031 garg_setup T apocalypse Fluffy_Pillow 1.0/100: 1% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), elemental_chaos_air
2:22.405 generic c scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_air
2:23.687 generic d festering_strike Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_air
2:24.969 generic b death_coil Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_air
2:26.252 generic c scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_air
2:27.535 generic b death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight, elemental_chaos_air
2:28.185 trinkets g use_item_dragon_games_equipment Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight, elemental_chaos_air
2:28.817 generic c scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight, elemental_chaos_air
2:30.100 generic c scourge_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(2), elemental_chaos_air
2:31.381 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), elemental_chaos_air
2:32.664 generic c scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(3), elemental_chaos_air
2:33.945 default H outbreak Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_air
2:35.227 generic b death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(4), elemental_chaos_air
2:36.508 generic c scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(4), elemental_chaos_air
2:37.791 generic b death_coil Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(5), elemental_chaos_air
2:39.074 generic c scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(5), elemental_chaos_air
2:40.358 generic d festering_strike Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_air
2:41.640 generic b death_coil Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_air
2:42.921 generic b death_coil Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_air
2:44.203 generic c scourge_strike Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), elemental_chaos_air
2:45.485 generic c scourge_strike Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(7), elemental_chaos_air
2:46.767 generic b death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), elemental_chaos_air
2:48.049 generic d festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_air
2:49.332 generic b death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), elemental_chaos_air
2:50.615 generic c scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), elemental_chaos_air
2:51.897 generic c scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, elemental_chaos_air
2:53.179 generic b death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
2:54.462 generic c scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_air
2:55.745 generic c scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
2:57.029 generic b death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
2:58.311 generic d festering_strike Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
2:59.592 generic b death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
3:00.875 Waiting     0.077 sec 7.0/100: 7% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:00.952 default H outbreak Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:02.277 Waiting     1.711 sec 17.0/100: 17% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:03.988 default F army_of_the_dead Fluffy_Pillow 22.0/100: 22% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:05.315 garg_setup X dark_transformation Fluffy_Pillow 32.0/100: 32% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:05.315 garg_setup V summon_gargoyle Fluffy_Pillow 32.0/100: 32% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_fire
3:06.640 default G death_coil Fluffy_Pillow 82.0/100: 82% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), elemental_chaos_fire
3:07.966 garg_setup T apocalypse Fluffy_Pillow 82.0/100: 82% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_fire
3:09.291 cooldowns Q empower_rune_weapon Fluffy_Pillow 99.0/100: 99% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_fire
3:09.291 cooldowns R unholy_assault Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_fire
3:09.291 trinkets f use_item_algethar_puzzle_box Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), elemental_chaos_fire
3:10.572 cooldowns S soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, elemental_chaos_fire
3:11.534 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:12.497 generic b death_coil Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:13.457 default E antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:13.457 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:14.417 generic b death_coil Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:15.379 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:16.342 cooldowns S soul_reaper Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, algethar_puzzle, elemental_chaos_fire
3:17.534 racials e berserking Fluffy_Pillow 53.0/100: 53% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, algethar_puzzle, elemental_chaos_fire
3:17.534 generic b death_coil Fluffy_Pillow 53.0/100: 53% runic_power
4.0/6: 67% rune		 berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, algethar_puzzle, elemental_chaos_fire
3:18.409 generic c scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
4.0/6: 67% rune		 berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight, algethar_puzzle, elemental_chaos_fire
3:19.282 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, elemental_chaos_fire
3:20.157 generic c scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
5.0/6: 83% rune		 berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, elemental_chaos_fire
3:21.031 generic b death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(3), algethar_puzzle, elemental_chaos_fire
3:21.906 generic c scourge_strike Fluffy_Pillow 9.0/100: 9% runic_power
5.0/6: 83% rune		 berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(3), algethar_puzzle, elemental_chaos_fire
3:22.780 cooldowns S soul_reaper Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), algethar_puzzle, elemental_chaos_fire
3:23.655 generic b death_coil Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), algethar_puzzle, elemental_chaos_fire
3:24.529 generic c scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), algethar_puzzle, elemental_chaos_fire
3:25.404 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), algethar_puzzle, elemental_chaos_fire
3:26.279 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), algethar_puzzle, elemental_chaos_fire
3:27.153 generic b death_coil Fluffy_Pillow 8.0/100: 8% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), algethar_puzzle, elemental_chaos_fire
3:28.026 default H outbreak Fluffy_Pillow 8.0/100: 8% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), algethar_puzzle, elemental_chaos_fire
3:28.902 cooldowns S soul_reaper Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), algethar_puzzle, elemental_chaos_fire
3:29.776 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(6), algethar_puzzle, elemental_chaos_fire
3:31.101 generic c scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(6), elemental_chaos_fire
3:32.425 generic c scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(7), elemental_chaos_fire
3:33.748 generic d festering_strike Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(8), elemental_chaos_fire
3:35.073 cooldowns S soul_reaper Fluffy_Pillow 89.0/100: 89% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(8), elemental_chaos_fire
3:36.398 generic b death_coil Fluffy_Pillow 99.0/100: 99% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, elemental_chaos_fire
3:37.723 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), elemental_chaos_fire
3:39.051 generic b death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 icy_talons(3), runic_corruption, elemental_chaos_fire
3:40.378 generic c scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 icy_talons(3), elemental_chaos_fire
3:41.702 cooldowns S soul_reaper Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune		 icy_talons(3), festermight, elemental_chaos_fire
3:43.030 generic b death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight, elemental_chaos_fire
3:44.357 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 icy_talons(3), runic_corruption, festermight, elemental_chaos_fire
3:45.681 generic d festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
4.0/6: 67% rune		 icy_talons(3), festermight, elemental_chaos_fire
3:47.006 generic c scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight, elemental_chaos_fire
3:48.330 cooldowns S soul_reaper Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight(2), elemental_chaos_fire
3:49.656 generic b death_coil Fluffy_Pillow 51.0/100: 51% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(2), elemental_chaos_fire
3:50.981 cooldowns P dark_transformation Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune		 icy_talons(3), runic_corruption, festermight(2), elemental_chaos_fire
3:52.307 garg_setup a scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_pact, festermight(2), elemental_chaos_fire
3:53.632 garg_setup T apocalypse Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_pact, festermight(3), elemental_chaos_fire
3:54.957 default E antimagic_shell PR_Death_Knight_Unholy 56.0/100: 56% runic_power
5.0/6: 83% rune		 icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
3:54.957 default H outbreak Fluffy_Pillow 56.0/100: 56% runic_power
5.0/6: 83% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
3:56.284 cooldowns S soul_reaper Fluffy_Pillow 71.0/100: 71% runic_power
4.0/6: 67% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
3:57.609 generic c scourge_strike Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
3:58.933 default G death_coil Fluffy_Pillow 99.0/100: 99% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_fire
4:00.258 generic b death_coil Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_air
4:01.540 generic d festering_strike Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, elemental_chaos_air
4:02.823 cooldowns S soul_reaper Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_air
4:04.107 generic b death_coil Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_air
4:05.391 generic c scourge_strike Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, elemental_chaos_air
4:06.676 generic b death_coil Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, sudden_doom, festermight, elemental_chaos_air
4:07.958 generic c scourge_strike Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight, elemental_chaos_air
4:09.240 cooldowns S soul_reaper Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), elemental_chaos_air
4:10.520 generic b death_coil Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
4:11.803 generic b death_coil Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
4:13.085 generic c scourge_strike Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
4:14.369 generic b death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
4:15.651 cooldowns S soul_reaper Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_air
4:16.933 generic c scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
4:18.217 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
4:19.500 generic c scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_air
4:20.781 generic c scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(5), elemental_chaos_air
4:22.063 default H outbreak Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(6), elemental_chaos_air
4:23.346 cooldowns S soul_reaper Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(6), elemental_chaos_air
4:24.628 generic b death_coil Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(6), elemental_chaos_air
4:25.910 generic b death_coil Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_air
4:27.192 generic d festering_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_air
4:28.185 trinkets g use_item_dragon_games_equipment Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_air
4:28.474 generic b death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dragon_games_equipment, elemental_chaos_air
4:29.758 cooldowns S soul_reaper Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_air
4:31.041 generic d festering_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_air
4:32.322 generic b death_coil Fluffy_Pillow 57.0/100: 57% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), elemental_chaos_air
4:33.605 generic d festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), elemental_chaos_air
4:34.887 default E antimagic_shell PR_Death_Knight_Unholy 52.0/100: 52% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), elemental_chaos_air
4:34.957 generic b death_coil Fluffy_Pillow 52.0/100: 52% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), elemental_chaos_air
4:36.240 cooldowns P dark_transformation Fluffy_Pillow 22.0/100: 22% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), elemental_chaos_air
4:37.525 Waiting     0.117 sec 27.0/100: 27% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_air
4:37.642 garg_setup a scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_air
4:38.925 garg_setup T apocalypse Fluffy_Pillow 40.0/100: 40% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight, elemental_chaos_air
4:40.208 cooldowns R unholy_assault Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_air
4:41.490 cooldowns S soul_reaper Fluffy_Pillow 57.0/100: 57% runic_power
4.0/6: 67% rune		 antimagic_shell, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), elemental_chaos_air
4:42.560 generic c scourge_strike Fluffy_Pillow 72.0/100: 72% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), elemental_chaos_air
4:43.628 generic b death_coil Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_air
4:44.699 generic b death_coil Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, unholy_pact, festermight(6), elemental_chaos_air
4:45.769 generic c scourge_strike Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_air
4:46.840 generic c scourge_strike Fluffy_Pillow 78.0/100: 78% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), elemental_chaos_air
4:47.910 cooldowns S soul_reaper Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), elemental_chaos_air
4:48.980 default H outbreak Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(8), elemental_chaos_air
4:50.048 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(8), elemental_chaos_air
4:51.117 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(8), elemental_chaos_air
4:52.186 generic b death_coil Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), elemental_chaos_air
4:53.255 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(8), elemental_chaos_air
4:54.325 cooldowns S soul_reaper Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), elemental_chaos_air
4:55.395 generic b death_coil Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), elemental_chaos_air
4:56.463 generic b death_coil Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), elemental_chaos_air
4:57.533 generic c scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), elemental_chaos_air
4:58.603 generic c scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, elemental_chaos_air
4:59.673 generic c scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight, elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6095 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6400 5922 0
Mastery 50.78% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowUnholy Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions+=/antimagic_zone,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
# Variables
actions+=/variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle
actions+=/variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4)|fight_remains<10
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&cooldown.apocalypse.remains|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
actions+=/wait_for_cooldown,name=apocalypse,if=cooldown.apocalypse.remains<gcd&buff.commander_of_the_dead_window.up
actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions+=/epidemic,if=active_enemies>=4&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions+=/unholy_blight,if=!buff.commander_of_the_dead_window.up&(variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21)
actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions+=/wound_spender,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup=0
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/scourge_strike,if=talent.superstrain&talent.ebon_fever&talent.plaguebringer&buff.plaguebringer.remains<gcd
actions.aoe+=/epidemic,if=(!talent.bursting_sores|rune<1|talent.bursting_sores&debuff.festering_wound.stack=0)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30)
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&debuff.festering_wound.stack<4&(cooldown.vile_contagion.remains<5|cooldown.apocalypse.ready&cooldown.any_dnd.remains)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10|cooldown.death_and_decay.remains>5&death_knight.fwounded_targets=active_enemies

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/summon_gargoyle,if=active_enemies>=3
actions.cooldowns+=/abomination_limb,if=rune<2&variable.adds_remain
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead|cooldown.dark_transformation.remains>30)
actions.cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.adds_remain&debuff.festering_wound.stack<2
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Garg Setup
actions.garg_setup=apocalypse,if=buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
actions.garg_setup+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
actions.garg_setup+=/potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
actions.garg_setup+=/death_coil,if=rune<=1
actions.garg_setup+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
actions.generic+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground)&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 50350 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50350.1 50350.1 34.0 / 0.067% 5893.7 / 11.7% 239.0
APS APS Error APS Range APR
477.4 1.9 / 0.408% 241.3 / 50.5% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
177.0 175.9 Mana 0.00% 45.4 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk0CBAAAAAAAAAAAAQikkSkmU0iEJlESEkGJJJShgEESTahkAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 50350
Devouring Plague 11617 23.1% 50.3 5.96sec 69228 62596 Direct 50.3 24311 51996 29631 19.2%
Periodic 128.6 13043 26854 15495 17.8% 85.9%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.31 50.31 128.58 128.58 29.72 1.1060 2.0046 3483174.02 3483174.02 0.00% 11114.54 62596.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 40.65 24 61 24310.53 16755 38247 24298.35 22355 26663 988128 988128 0.00%
crit 19.22% 9.67 1 25 51995.50 33509 76493 52056.53 38910 69751 502712 502712 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.25% 105.75 70 140 13043.10 91 32848 13045.65 11544 14876 1379307 1379307 0.00%
crit 17.75% 22.83 8 44 26854.23 186 62509 26870.16 18060 34202 613028 613028 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.887036
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.737256
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 88.7%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [W]:50.31
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
Halo 0 (254) 0.0% (0.5%) 3.5 77.83sec 21749 18783

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.51 0.00 0.00 0.00 0.00 1.1581 0.0000 0.00 0.00 0.00% 18783.19 18783.19

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:10.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$=}<shadowhalodamage> Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m2=1000}/100} Insanity.|r][]

Action Priority List

    filler
    [P]:3.53
  • if_expr:raid_event.adds.in>20
    Halo (_damage) 254 0.5% 3.5 77.83sec 21749 0 Direct 3.5 19132 39597 21965 13.8%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.51 3.48 0.00 0.00 0.00 0.0000 0.0000 76334.89 76334.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.16% 2.99 0 6 19131.73 15741 33829 18973.14 0 31600 57283 57283 0.00%
crit 13.84% 0.48 0 4 39597.43 31482 67657 15578.43 0 67657 19052 19052 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$=}<holyhalodamage> Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (2783) 0.0% (5.5%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 7116  / 2783 5.5% 19.2 14.32sec 43588 5822 Periodic 143.5 4995 10121 5822 16.1% 47.8%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.17 0.00 143.52 143.52 0.00 7.4870 1.0000 835554.48 835554.48 0.00% 5821.79 5821.79
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.87% 120.38 28 289 4995.04 3703 6701 4993.56 4689 5513 601290 601290 0.00%
crit 16.13% 23.15 2 62 10121.20 7407 13402 10107.78 9246 11544 234265 234265 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:3.42
Mind Blast 5680 11.3% 62.1 4.81sec 27417 24879 Direct 62.1 21973 46584 27417 22.1%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.09 62.09 0.00 0.00 0.00 1.1020 0.0000 1702293.22 1702293.22 0.00% 24879.33 24879.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.88% 48.35 28 75 21973.04 11787 38043 21971.18 19534 24485 1062492 1062492 0.00%
crit 22.12% 13.73 2 30 46584.48 23573 76086 46624.08 35290 60159 639801 639801 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.52

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [V]:7.41
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [a]:54.83
  • if_expr:variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Mind Flay 353 0.7% 3.1 62.06sec 34009 9539 Periodic 18.5 4980 10088 5706 14.2% 3.6%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.11 0.00 18.55 18.55 0.00 3.5656 0.5840 105831.40 105831.40 0.00% 9538.66 9538.66
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 85.80% 15.91 0 54 4980.46 4168 7377 4845.61 0 7189 79262 79262 0.00%
crit 14.20% 2.63 0 14 10087.54 8335 14754 8673.90 0 14754 26569 26569 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.324852
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    filler
    [N]:14.38
  • if_expr:buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    filler
    [R]:3.14
  • interrupt_if_expr:ticks>=2
    main
    [Y]:22.85
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
Mind Flay: Insanity 6944 13.8% 37.3 7.92sec 55916 25310 Periodic 148.4 11970 24439 14038 16.6% 27.4%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.26 0.00 148.41 148.41 0.00 2.2093 0.5547 2083436.99 2083436.99 0.00% 25309.62 25309.62
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.42% 123.80 78 184 11970.41 8485 17045 11967.58 11420 12783 1481954 1481954 0.00%
crit 16.58% 24.61 8 48 24439.35 16970 34090 24436.61 22494 27315 601483 601483 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.714674
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 877 1.7% 8.5 28.48sec 30839 27058 Direct 8.5 26511 56500 30840 14.4%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.54 8.54 0.00 0.00 0.00 1.1398 0.0000 263277.98 263277.98 0.00% 27058.37 27058.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.57% 7.31 0 20 26511.42 18077 55554 26503.15 0 48339 193676 193676 0.00%
crit 14.43% 1.23 0 7 56500.02 39769 111108 39382.07 0 111108 69602 69602 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.607200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=true}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    filler
    [O]:8.54
  • if_expr:buff.surge_of_darkness.up
Mindgames 1369 2.7% 7.7 40.68sec 53584 48899 Direct 7.7 (7.7) 43250 94795 53585 20.0% (20.0%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 0.00 1.0959 0.0000 410166.07 410166.07 0.00% 48899.15 48899.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.95% 6.12 1 10 43249.71 27910 69296 43183.68 34025 57915 264687 264687 0.00%
crit 20.05% 1.53 0 7 94795.44 55821 138592 78568.38 0 138592 145479 145479 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m8=1000}/100} Insanity.|r][]

Action Priority List

    main
    [b]:7.68
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1068) 0.0% (2.1%) 8.0 35.62sec 40209 35182

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.97 0.00 0.00 0.00 0.00 1.1429 0.0000 0.00 0.00 0.00% 35182.32 35182.32

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [c]:7.97
  • if_expr:!variable.holding_crash
    Shadow Crash (_damage) 1068 2.1% 8.9 35.52sec 35964 0 Direct 8.9 30147 64125 35963 17.1%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.92 8.92 0.00 0.00 0.00 0.0000 0.0000 320651.62 320651.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.88% 7.39 2 11 30146.73 20814 49353 30074.56 21760 37069 222767 222767 0.00%
crit 17.12% 1.53 0 7 64124.68 41627 98706 52334.84 0 98706 97884 97884 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 660 1.3% 130.6 2.24sec 1511 0 Direct 129.5 1524 0 1524 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.59 129.48 0.00 0.00 0.00 0.0000 0.0000 197325.01 197325.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 129.48 92 159 1523.96 353 4883 1525.27 1237 2018 197325 197325 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1185.71
  • base_dd_max:1185.71
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 1178 2.3% 11.9 26.36sec 29791 26536 Direct 11.9 24594 50449 29791 20.1%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.86 11.86 0.00 0.00 0.00 1.1227 0.0000 353299.42 353299.42 0.00% 26535.93 26535.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.90% 9.48 2 16 24593.68 10916 54892 24569.61 14234 36556 233028 233028 0.00%
crit 20.10% 2.38 0 8 50448.99 21832 109783 46559.28 0 109783 120271 120271 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    filler
    [Q]:0.08
  • if_expr:target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
  • target_if_expr:target.time_to_die
    main
    [Z]:11.78
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
Shadow Word: Pain 3039 6.0% 17.2 17.53sec 53084 0 Periodic 251.6 3057 6252 3622 17.7% 98.8%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.17 0.00 251.65 251.65 15.58 0.0000 1.1775 911445.20 911445.20 0.00% 3075.94 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.32% 207.15 153 266 3057.00 2 4358 3056.22 2916 3225 633266 633266 0.00%
crit 17.68% 44.50 22 75 6251.64 4 8716 6252.26 5808 6938 278179 278179 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.91
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (1320) 0.0% (2.6%) 112.0 2.66sec 3537 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.01 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 1320 2.6% 110.4 2.65sec 3588 0 Direct 108.7 3646 0 3646 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 110.41 108.66 0.00 0.00 0.00 0.0000 0.0000 396163.80 396163.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 108.66 79 140 3645.78 2347 5828 3644.12 3454 3864 396164 396164 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205700
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 1251 2.5% 7.2 37.40sec 51754 0 Periodic 86.2 4352 0 4352 0.0% 38.8%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.25 0.00 86.21 86.21 2.47 0.0000 1.3507 375165.90 375165.90 0.00% 3222.00 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 86.21 17 188 4351.80 30 4896 4349.28 4228 4718 375166 375166 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:4032.41
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1922}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 3631 7.2% 17.2 17.53sec 63409 117663 Periodic 165.1 5567 11393 6594 17.6% 98.7%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.17 0.00 165.11 165.11 15.58 0.5389 1.7929 1088738.61 1088738.61 0.00% 3566.54 117663.31
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.37% 135.99 97 176 5566.77 4 7948 5565.27 5327 5888 757048 757048 0.00%
crit 17.63% 29.11 10 54 11393.47 23 15895 11395.70 10317 12700 331691 331691 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [X]:8.25
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
  • target_if_expr:remains
Void Torrent 3080 6.1% 4.9 65.77sec 188810 58367 Periodic 28.7 26331 53683 32136 21.2% 4.9%

Stats Details: Void Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.88 0.00 28.68 28.68 0.00 3.2350 0.5078 921613.95 921613.95 0.00% 58366.94 58366.94
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.78% 22.59 11 35 26331.17 660 38467 26319.29 22151 31401 594910 594910 0.00%
crit 21.22% 6.09 0 17 53683.00 1386 76934 53558.38 0 76934 326704 326704 0.00%

Action Details: Void Torrent

  • id:263165
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:15.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.612870
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:263165
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=0} Shadow damage to the target every {$t1=1} sec.
  • description:Channel a torrent of void energy into the target, dealing {$=}o Shadow damage over {$d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$289577s1=1500}*{$289577s2=4}/100} Insanity over the duration.|r

Action Priority List

    main
    [d]:4.88
  • if_expr:insanity<=35&!variable.holding_crash
  • target_if_expr:variable.all_dots_up
pet - mindbender 11392 / 5244
Inescapable Torment 0 (2836) 0.0% (5.6%) 41.1 7.11sec 20643 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 6155 5.6% 41.1 7.11sec 20643 0 Direct 41.1 16416 34196 20643 23.8%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.13 41.13 0.00 0.00 0.00 0.0000 0.0000 848934.89 848934.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.23% 31.35 13 53 16416.10 9259 24138 16412.37 14575 18837 514625 514625 0.00%
crit 23.77% 9.78 1 24 34195.75 18518 48275 34222.89 27170 48275 334310 334310 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 5237 4.8% 130.6 2.24sec 5520 5341 Direct 130.6 4483 9098 5520 22.5%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.59 130.59 0.00 0.00 0.00 1.0335 0.0000 720850.62 720850.62 0.00% 5341.18 5341.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.53% 101.25 63 138 4483.40 3944 6103 4481.53 4217 4861 453935 453935 0.00%
crit 22.47% 29.34 11 52 9097.61 7887 12205 9098.99 8422 10130 266915 266915 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 0
Mental Fortitude 477 100.0% 329.9 0.90sec 434 0 Direct 340.8 420 0 420 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 329.88 340.78 0.00 0.00 0.00 0.0000 0.0000 143018.50 6872594.12 97.92% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 340.78 254 426 419.68 0 26622 420.22 257 630 143018 6872594 97.91%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21610.00
  • base_dd_max:21610.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 123.43sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [I]:2.95
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.81sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 103.17 0.00 0.00 1.1671 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [K]:5.35
  • if_expr:pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
Desperate Prayer 0.3 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.30 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [M]:0.30
  • if_expr:health.pct<=75
Devouring Plague (_heal) 178.9 1.66sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 178.89 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 88.7%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 3.5 77.83sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.51 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$=}<holyhalodamage> Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.84sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.44 0.00 0.00 0.00 0.00 1.1688 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    main
    [U]:5.44
  • if_expr:(variable.dots_up|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
Mindgames (_damage_reversal) 7.7 40.68sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.65 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.5 304.13sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [H]:1.48
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Power Infusion 2.9 123.64sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%. Can only be cast on players.

Action Priority List

    cds
    [J]:2.92
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.0 35.62sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.97 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 2.9 123.39sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 165.1 1.80sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 165.11 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2384.30
  • base_dd_max:2384.30
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.8sec 61.8sec 19.4sec 34.44% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 64.6s
  • trigger_min/max:61.1s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.67%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.68%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.69%
  • ancient_madness_6:1.70%
  • ancient_madness_7:1.70%
  • ancient_madness_8:1.71%
  • ancient_madness_9:1.71%
  • ancient_madness_10:1.72%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.73%
  • ancient_madness_13:1.74%
  • ancient_madness_14:1.74%
  • ancient_madness_15:1.75%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.76%
  • ancient_madness_18:1.77%
  • ancient_madness_19:1.77%
  • ancient_madness_20:1.78%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 3.0 0.0 123.4sec 123.4sec 14.7sec 14.51% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 127.7s
  • trigger_min/max:120.0s / 127.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.51%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 53.9 142.1 5.6sec 1.5sec 3.5sec 62.66% 75.56% 68.3 (68.3) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 41.3s
  • trigger_min/max:0.0s / 37.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s

Stack Uptimes

  • coalescing_shadows_1:21.28%
  • coalescing_shadows_2:14.05%
  • coalescing_shadows_3:27.34%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 2.1 51.1 121.9sec 5.6sec 137.2sec 97.78% 98.71% 51.1 (51.1) 1.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 354.6s
  • trigger_min/max:0.0s / 43.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.3s

Stack Uptimes

  • coalescing_shadows_dot_1:97.78%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.8sec 61.8sec 19.4sec 34.44% 40.82% 98.2 (98.2) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 64.6s
  • trigger_min/max:61.1s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.44%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 194.6 194.6sec 1.5sec 292.4sec 97.80% 98.21% 190.6 (190.6) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:69.2s / 325.0s
  • trigger_min/max:0.0s / 29.9s
  • trigger_pct:100.00%
  • duration_min/max:2.3s / 354.0s

Stack Uptimes

  • dark_evangelism_1:0.13%
  • dark_evangelism_2:0.13%
  • dark_evangelism_3:0.13%
  • dark_evangelism_4:0.56%
  • dark_evangelism_5:96.85%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Death and Madness (_insanity_gain) 0.4 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.6 0.0 24.2sec 24.2sec 16.8sec 14.39% 0.00% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.7s / 45.4s
  • trigger_min/max:20.7s / 45.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:14.39%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.3 0.0 0.0sec 0.0sec 9.2sec 0.93% 0.00% 2.5 (2.5) 0.3

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.93%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 60.5sec 0.0sec 22.5sec 10.90% 12.75% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 33.0s

Stack Uptimes

  • devoured_pride_1:10.90%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 304.1sec 304.1sec 27.4sec 13.27% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 313.5s
  • trigger_min/max:300.0s / 313.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.27%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mental Fortitude 4.3 325.6 85.9sec 0.9sec 65.8sec 94.10% 100.00% 325.6 (325.6) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.4s / 338.2s
  • trigger_min/max:0.0s / 42.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 335.6s

Stack Uptimes

  • mental_fortitude_1:94.10%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Flay: Insanity 37.8 12.6 8.0sec 6.0sec 3.5sec 43.93% 0.00% 12.6 (12.6) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 37.7s
  • trigger_min/max:0.9s / 18.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.6s

Stack Uptimes

  • mind_flay_insanity_1:43.93%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Melt 6.8 1.7 36.8sec 28.5sec 5.0sec 11.44% 9.12% 0.2 (0.2) 0.3

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_melt
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 317.2s
  • trigger_min/max:0.8s / 317.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • mind_melt_1:9.27%
  • mind_melt_2:2.17%

Spelldata

  • id:391092
  • name:Mind Melt
  • tooltip:The cast time of your next Mind Blast is reduced by {$=}w1% and its critical strike chance is increased by {$s2=25}%.
  • description:{$@spelldesc391090=Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times. Lasts {$391092d=10 seconds}.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.6sec 123.6sec 19.4sec 19.00% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.3s / 127.7s
  • trigger_min/max:122.3s / 127.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:19.00%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%. Can only be cast on players.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 16.9 1.2 17.3sec 16.1sec 1.9sec 10.64% 27.35% 1.2 (1.2) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.5s / 77.3s
  • trigger_min/max:0.1s / 77.3s
  • trigger_pct:7.19%
  • duration_min/max:0.0s / 15.2s

Stack Uptimes

  • shadowy_insight_1:10.64%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.1sec 45.7sec 16.6sec 23.67% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 209.8s
  • trigger_min/max:0.0s / 198.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 88.4s

Stack Uptimes

  • sophic_devotion_1:23.67%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.8 0.0 158.9sec 158.9sec 19.4sec 4.91% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 251.3s
  • trigger_min/max:120.0s / 251.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:4.91%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.7 0.0 159.7sec 159.7sec 19.4sec 4.63% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 250.3s
  • trigger_min/max:120.0s / 250.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:4.63%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.7 0.0 157.2sec 157.2sec 19.5sec 4.81% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 250.6s
  • trigger_min/max:120.0s / 250.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:4.81%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.7 0.0 158.6sec 158.6sec 19.4sec 4.83% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 250.8s
  • trigger_min/max:120.0s / 250.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:4.83%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 12.5 15.0 23.8sec 10.5sec 13.0sec 54.11% 100.00% 4.1 (4.1) 8.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 153.7s
  • trigger_min/max:0.0s / 144.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 99.5s

Stack Uptimes

  • surge_of_darkness_1:25.27%
  • surge_of_darkness_2:14.45%
  • surge_of_darkness_3:14.39%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 205.9 0.0sec 0.5sec 104.4sec 34.78% 32.83% 205.9 (205.9) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.8s
  • trigger_pct:100.00%
  • duration_min/max:81.0s / 125.9s

Stack Uptimes

  • twist_of_fate_1:34.78%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Void Torrent 4.9 0.0 65.8sec 65.8sec 3.0sec 4.86% 0.00% 0.0 (0.0) 4.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 143.5s
  • trigger_min/max:60.0s / 143.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s

Stack Uptimes

  • void_torrent_1:4.86%

Spelldata

  • id:263165
  • name:Void Torrent
  • tooltip:Dealing {$s1=0} Shadow damage to the target every {$t1=1} sec.
  • description:Channel a torrent of void energy into the target, dealing {$=}o Shadow damage over {$d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$289577s1=1500}*{$289577s2=4}/100} Insanity over the duration.|r
  • max_stacks:0
  • duration:3.00
  • cooldown:60.00
  • default_chance:0.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 50.1 37.0 64.0 6.0s 0.9s 25.6s
Shadowy Apparition from Mind Blast 61.9 43.0 83.0 4.8s 0.0s 21.9s
Void Tendril proc from Idol of C'Thun 9.8 2.0 24.0 28.4s 0.3s 129.5s
Shadowy Insight procs 16.9 6.0 30.0 17.3s 0.5s 77.3s
Shadowy Insight procs lost to overflow 1.2 0.0 7.0 80.0s 0.5s 334.9s
Shadowy Insight procs not consumed 0.0 0.0 2.0 41.3s 41.3s 41.3s
Coalescing Shadows from Mind Fay 41.7 18.0 71.0 6.9s 0.3s 97.2s
Coalescing Shadows from Shadow Word: Pain 15.1 2.0 33.0 18.6s 0.1s 236.3s
Coalescing Shadows from Shadowy Apparition 8.6 0.0 22.0 30.1s 0.0s 280.3s
Surge of Darkness from Vampiric Touch 13.2 2.0 28.0 21.2s 0.0s 233.1s
Surge of Darkness from Devouring Plague 14.3 2.0 32.0 19.7s 0.0s 201.9s
Mind Blast that consumed Mind Melt and Shadowy Insight 1.5 0.0 8.0 84.8s 2.4s 325.2s
Mind Flay: Insanity casts that did not channel for full ticks 0.2 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.8s 60.0s 64.5s
Void Torrent ticks without full Mastery value 1.0 0.0 10.0 13.2s 0.0s 272.4s
Mindgames casts without full Mastery value 1.6 0.0 6.0 88.2s 32.0s 280.4s
Inescapable Torment expired when Mind Blast was ready 3.6 0.0 8.0 93.2s 0.0s 337.5s
Inescapable Torment expired when Shadow Word: Death was ready 1.2 0.0 7.0 119.7s 0.0s 335.3s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 84.32% 72.52% 89.37% 13.8s 0.0s 65.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Auspicious SpiritsInsanity112.00109.034.26%0.972.982.66%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity143.52284.7011.14%1.982.350.82%
MindbenderInsanity130.58381.2314.91%2.9210.522.69%
Throes of PainInsanity0.884.370.17%4.980.020.47%
Dark AscensionInsanity5.33158.626.20%29.751.360.85%
HaloInsanity3.5135.101.37%10.000.000.00%
mana_regenMana833.1052770.32100.00%63.34426579.6088.99%
Mind BlastInsanity62.09371.0214.51%5.981.500.40%
Mind FlayInsanity18.5537.061.45%2.000.040.10%
Mind Flay: InsanityInsanity148.42593.5223.22%4.000.140.02%
Mind SpikeInsanity8.5434.151.34%4.000.000.00%
MindgamesInsanity7.6576.552.99%10.000.000.00%
Shadow CrashInsanity8.97134.625.27%15.000.000.00%
Vampiric TouchInsanity8.2533.021.29%4.000.000.00%
Void TorrentInsanity23.84303.6211.88%12.7354.0015.10%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 50.312515.7250.0050.001384.56
MindgamesMana 7.6538272.905000.004999.9710.72
Shadow Word: DeathMana 11.8614823.861250.001249.9823.83
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 305.17 300.16 1622266.5 211406.5 54528.2 216100.0
Mana 49999.0 175.90 176.99 426578.9 49672.6 43753.8 49999.0
Insanity 15.0 8.52 8.39 72.9 40.9 0.0 100.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 50350.13
Minimum 45455.05
Maximum 57105.44
Spread ( max - min ) 11650.39
Range [ ( max - min ) / 2 * 100% ] 11.57%
Standard Deviation 1501.5810
5th Percentile 48005.75
95th Percentile 52928.01
( 95th Percentile - 5th Percentile ) 4922.26
Mean Distribution
Standard Deviation 17.3399
95.00% Confidence Interval ( 50316.15 - 50384.12 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3417
0.1 Scale Factor Error with Delta=300 19248
0.05 Scale Factor Error with Delta=300 76992
0.01 Scale Factor Error with Delta=300 1924781
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 50350.13
Minimum 45455.05
Maximum 57105.44
Spread ( max - min ) 11650.39
Range [ ( max - min ) / 2 * 100% ] 11.57%
Standard Deviation 1501.5810
5th Percentile 48005.75
95th Percentile 52928.01
( 95th Percentile - 5th Percentile ) 4922.26
Mean Distribution
Standard Deviation 17.3399
95.00% Confidence Interval ( 50316.15 - 50384.12 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3417
0.1 Scale Factor Error with Delta=300 19248
0.05 Scale Factor Error with Delta=300 76992
0.01 Scale Factor Error with Delta=300 1924781
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 50350.13
Minimum 45455.05
Maximum 57105.44
Spread ( max - min ) 11650.39
Range [ ( max - min ) / 2 * 100% ] 11.57%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 12688918.08
Minimum 9572622.10
Maximum 15647332.81
Spread ( max - min ) 6074710.71
Range [ ( max - min ) / 2 * 100% ] 23.94%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 299.24
Minimum 0.00
Maximum 1054.94
Spread ( max - min ) 1054.94
Range [ ( max - min ) / 2 * 100% ] 176.27%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 303.89
Minimum 0.00
Maximum 996.53
Spread ( max - min ) 996.53
Range [ ( max - min ) / 2 * 100% ] 163.96%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 variable,name=mind_sear_cutoff,op=set,value=2
7 0.00 variable,name=pool_amount,op=set,value=60
8 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
9 0.00 mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
A 0.00 vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<20
B 0.00 run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
C 0.00 run_action_list,name=main
actions.cds
# count action,conditions
H 1.48 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Todo Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
I 2.95 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
J 2.92 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
K 5.35 dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
L 0.00 call_action_list,name=trinkets
M 0.30 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
N 14.38 mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
O 8.54 mind_spike,if=buff.surge_of_darkness.up
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
P 3.53 halo,if=raid_event.adds.in>20
Save up to 20s if adds are coming soon.
Q 0.08 shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
0.00 divine_star,if=raid_event.adds.in>10
Save up to 10s if adds are coming soon.
0.00 mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
R 3.14 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=min:remains
Use Shadow Word: Pain while moving as a low-priority action
actions.main
# count action,conditions
S 0.00 call_action_list,name=main_variables
T 0.00 call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
U 5.44 mindbender,if=(variable.dots_up|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
V 7.41 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
High priority Mind Blast action when using Inescapable Torment
0.00 damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
W 50.31 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
X 8.25 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
0.00 shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
Y 22.85 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
Z 11.78 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
a 54.83 mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
b 7.68 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
c 7.97 shadow_crash,if=!variable.holding_crash
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
d 4.88 void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
e 0.00 call_action_list,name=filler
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance
f 2.95 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)
Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks

Sample Sequence

0124678UKJHIfVWZabNWadWaNWaXaNWNaWYOaaOWYacWYbaOOWYaPWYRWaXYUWKVZWaaaWbacWadWYaWYaPRWXaYaOaWYabcWYaRUWKJIfZaaWNaaOWXaWdWacNWZaYWYaWYaWYaXPRWaaYacUWZKaWbNWaNRWaVWXadWYaWYcaWYabaWYPRWaYUWXKJIfVWZZaMacWaNWNaaWbNWaVZZNWXadWYaWYaWaYaW

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 6 mind_sear_cutoff PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
Pre precombat 7 pool_amount PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
Pre precombat 8 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
0:00.000 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity		 bloodlust, shadowform, static_empowerment
0:00.941 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, coalescing_shadows, static_empowerment
0:01.881 cds J power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 bloodlust, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2)
0:01.881 cds H potion Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 bloodlust, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2)
0:01.881 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 bloodlust, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2), elemental_potion_of_ultimate_power
0:01.881 trinkets f use_items Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2), elemental_potion_of_ultimate_power
0:01.881 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(2), elemental_potion_of_ultimate_power
0:02.635 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(20), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.390 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(19), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.145 main a mind_blast Fluffy_Pillow 49957.0/49999: 100% mana
15.0/100: 15% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(18), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:04.898 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(17), mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.653 filler N mind_flay Fluffy_Pillow 45010.2/49999: 90% mana
38.0/100: 38% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(17), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.154 main W devouring_plague Fluffy_Pillow 47411.8/49999: 95% mana
60.0/100: 60% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(15), mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.909 main a mind_blast Fluffy_Pillow 48619.8/49999: 97% mana
14.0/100: 14% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(14), mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.663 main d void_torrent Fluffy_Pillow 49826.2/49999: 100% mana
24.0/100: 24% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(14), mental_fortitude, dark_evangelism(4), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.942 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(10), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.695 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(10), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.449 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(9), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.949 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(7), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.704 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(7), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.459 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity		 bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(6), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.212 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity		 bloodlust, power_infusion, shadowform, ancient_madness(5), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.967 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity		 bloodlust, power_infusion, shadowform, ancient_madness(4), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.469 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity		 bloodlust, power_infusion, shadowform, ancient_madness(3), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.224 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 bloodlust, power_infusion, shadowform, ancient_madness(2), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.724 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 bloodlust, power_infusion, shadowform, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.478 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity		 bloodlust, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.417 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 bloodlust, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.291 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 bloodlust, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.231 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.170 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity		 bloodlust, shadowform, surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.109 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.049 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity		 bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.988 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, mind_flay_insanity, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.860 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity		 bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.798 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:33.738 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:34.677 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:36.549 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:37.487 main a mind_blast Fluffy_Pillow 45003.8/49999: 90% mana
60.0/100: 60% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:38.425 filler O mind_spike Fluffy_Pillow 46504.6/49999: 93% mana
69.0/100: 69% insanity		 bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:39.364 filler O mind_spike Fluffy_Pillow 48007.0/49999: 96% mana
75.0/100: 75% insanity		 bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
0:40.302 main W devouring_plague Fluffy_Pillow 49507.8/49999: 99% mana
81.0/100: 81% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), static_empowerment(5)
0:41.522 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), mind_flay_insanity, static_empowerment(5)
0:43.960 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_melt(2), static_empowerment(5)
0:45.182 filler P halo Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:46.404 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:47.625 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:50.062 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:53.714 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:54.936 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:56.155 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:57.373 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:59.810 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:01.220 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, devoured_pride, static_empowerment(5)
1:02.440 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity		 shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, static_empowerment(5)
1:03.660 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 shadowform, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:04.879 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity		 shadowform, ancient_madness(19), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:06.100 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 shadowform, ancient_madness(18), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:07.320 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity		 shadowform, ancient_madness(17), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:08.541 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity		 shadowform, ancient_madness(16), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:09.764 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity		 shadowform, ancient_madness(14), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:10.983 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity		 shadowform, ancient_madness(13), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:12.205 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity		 shadowform, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:13.426 main a mind_blast Fluffy_Pillow 45007.0/49999: 90% mana
26.0/100: 26% insanity		 shadowform, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:14.651 main c shadow_crash Fluffy_Pillow 46967.0/49999: 94% mana
36.0/100: 36% insanity		 shadowform, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:15.871 main W devouring_plague Fluffy_Pillow 48919.0/49999: 98% mana
54.0/100: 54% insanity		 shadowform, ancient_madness(8), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:17.094 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity		 shadowform, ancient_madness(7), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:18.314 main d void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity		 shadowform, ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:21.497 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity		 shadowform, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, devoured_pride, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:22.718 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity		 shadowform, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:25.155 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:26.375 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:27.597 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:30.032 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:31.251 filler P halo Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:32.472 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:36.124 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:37.344 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:38.566 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:39.786 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:42.223 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:43.443 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:44.663 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 shadowform, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
1:45.884 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:47.105 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:49.543 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:50.764 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:51.983 main c shadow_crash Fluffy_Pillow 45003.8/49999: 90% mana
43.0/100: 43% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:53.203 main W devouring_plague Fluffy_Pillow 46955.8/49999: 94% mana
60.0/100: 60% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:54.425 main Y mind_flay Fluffy_Pillow 48911.0/49999: 98% mana
13.0/100: 13% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:56.862 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:58.082 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:01.736 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:02.956 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:04.178 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity		 shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:05.398 cds J power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
2:05.398 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
2:05.398 trinkets f use_items Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
2:05.398 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:06.376 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:07.353 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:08.330 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(18), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:09.305 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(17), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:11.254 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(15), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:12.229 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:13.206 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:14.184 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:15.162 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_melt, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:16.140 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:17.117 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:18.094 main d void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
6.0/100: 6% insanity		 blood_fury, power_infusion, shadowform, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:21.537 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
93.0/100: 93% insanity		 power_infusion, shadowform, ancient_madness(4), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:22.514 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity		 power_infusion, shadowform, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:23.490 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity		 power_infusion, shadowform, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:24.468 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity		 power_infusion, shadowform, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5)
2:26.418 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
99.0/100: 99% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:27.639 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:28.862 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:30.083 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:32.520 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
94.0/100: 94% insanity		 shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:33.740 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity		 shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:36.177 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:37.398 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:38.619 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:41.054 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:42.275 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:43.496 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:45.934 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:47.154 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:48.374 filler P halo Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:49.595 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:53.247 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 shadowform, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:54.468 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity		 shadowform, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:55.690 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
16.0/100: 16% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:56.909 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity		 shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:59.344 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:00.565 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:01.785 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity		 shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:03.005 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity		 shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:04.225 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity		 shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:05.444 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity		 shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:06.664 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity		 shadowform, ancient_madness(20), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:07.886 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity		 shadowform, ancient_madness(19), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:09.108 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity		 shadowform, ancient_madness(18), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:10.329 filler N mind_flay Fluffy_Pillow 45007.0/49999: 90% mana
31.0/100: 31% insanity		 shadowform, ancient_madness(17), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:12.766 main W devouring_plague Fluffy_Pillow 48906.2/49999: 98% mana
53.0/100: 53% insanity		 shadowform, ancient_madness(14), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:13.986 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity		 shadowform, ancient_madness(13), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:15.206 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity		 twist_of_fate, shadowform, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:17.642 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity		 twist_of_fate, shadowform, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:21.294 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 twist_of_fate, shadowform, ancient_madness(6), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:22.515 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity		 twist_of_fate, shadowform, ancient_madness(5), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:23.734 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 twist_of_fate, shadowform, ancient_madness(3), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:24.954 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 twist_of_fate, shadowform, ancient_madness(2), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:26.176 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
16.0/100: 16% insanity		 twist_of_fate, shadowform, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:27.396 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:28.616 main d void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:31.873 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:33.092 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:35.529 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:36.749 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:37.970 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:40.406 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:41.627 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:42.846 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:44.065 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity		 twist_of_fate, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:46.501 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity		 twist_of_fate, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:47.722 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity		 twist_of_fate, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:48.943 main a mind_blast Fluffy_Pillow 45007.0/49999: 90% mana
42.0/100: 42% insanity		 twist_of_fate, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:50.162 main W devouring_plague Fluffy_Pillow 46957.4/49999: 94% mana
51.0/100: 51% insanity		 twist_of_fate, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:51.382 main Y mind_flay Fluffy_Pillow 48909.4/49999: 98% mana
6.0/100: 6% insanity		 twist_of_fate, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:53.819 filler P halo Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:55.040 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:58.692 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), static_empowerment(5)
3:59.914 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), mind_flay_insanity, static_empowerment(5)
4:01.136 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity		 twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:03.573 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:04.792 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:06.011 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity		 twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:07.230 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity		 twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:08.452 cds J power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity		 twist_of_fate, shadowform, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.452 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity		 power_infusion, twist_of_fate, shadowform, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.452 trinkets f use_items Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity		 blood_fury, power_infusion, twist_of_fate, shadowform, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.452 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity		 blood_fury, power_infusion, twist_of_fate, shadowform, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:09.429 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity		 blood_fury, power_infusion, twist_of_fate, shadowform, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:10.405 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity		 blood_fury, power_infusion, twist_of_fate, shadowform, ancient_madness(19), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:11.383 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(18), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:12.359 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(17), surge_of_darkness(2), shadowy_insight, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:13.335 cds M desperate_prayer PR_Priest_Shadow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(16), surge_of_darkness(2), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:13.335 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(16), surge_of_darkness(2), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:14.313 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(15), surge_of_darkness(2), dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:15.289 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
94.0/100: 94% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(14), surge_of_darkness(2), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:16.268 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(13), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:17.246 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(12), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:19.195 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(10), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:20.172 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(9), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:22.121 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(7), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:23.099 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(6), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:24.077 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(5), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:25.054 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(4), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:26.033 filler N mind_flay Fluffy_Pillow 45008.6/49999: 90% mana
47.0/100: 47% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(3), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:27.983 main W devouring_plague Fluffy_Pillow 48128.6/49999: 96% mana
69.0/100: 69% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness, surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:28.962 main a mind_blast Fluffy_Pillow 49695.0/49999: 99% mana
23.0/100: 23% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:30.183 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:31.403 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:32.623 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:33.842 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:36.277 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:37.498 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity		 twist_of_fate, death_and_madness_reset, shadowform, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:38.719 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity		 twist_of_fate, death_and_madness_reset, shadowform, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:39.939 main d void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 twist_of_fate, death_and_madness_reset, shadowform, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:43.233 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
93.0/100: 93% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:44.453 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:46.889 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
4:48.111 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:49.331 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity		 twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:51.767 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:52.989 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:54.211 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:55.432 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:57.870 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:59.090 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [31]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk0CBAAAAAAAAAAAAQikkSkmU0iEJlESEkGJJJShgEESTahkAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
# otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/variable,name=pool_amount,op=set,value=60
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
actions.precombat+=/mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)

# Executed every time the actor is available.
actions=variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/variable,name=holding_crash,op=set,value=raid_event.adds.in<20
actions+=/run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight
actions.aoe+=/shadow_crash,if=!variable.holding_crash
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.aoe+=/dark_void,if=raid_event.adds.in>10
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
# actions.aoe+=/run_action_list,name=aoe_pl_ire,if=talent.psychic_link.rank=2&talent.insidious_ire.rank=2 Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,if=cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time&talent.mind_devourer.rank=2&spell_targets.mind_sear>=3&!buff.mind_devourer.up&spell_targets.mind_sear<=7
actions.aoe+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.aoe+=/void_bolt,if=insanity<=85
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks, or mind devourer is up on 2+ targets. If Mind Devourer is up do not cancel mind sear.
actions.aoe+=/mind_sear,target_if=max:spell_targets.mind_sear,if=buff.mind_devourer.up&spell_targets.mind_sear>1|spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3))&!variable.pool_for_cds,early_chain_if=ticks>=2&!buff.mind_devourer_ms_active.up,interrupt_immediate=1,interrupt_if=ticks>=2&!buff.mind_devourer_ms_active.up
actions.aoe+=/call_action_list,name=pl_torrent,if=talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=3&(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&((insanity>=50|dot.devouring_plague.ticking|buff.dark_reveries.up)|buff.voidform.up|buff.dark_ascension.up)
actions.aoe+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75&(!buff.mind_flay_insanity.up&talent.mind_flay_insanity|!talent.psychic_link))&variable.dp_cutoff
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight
actions.aoe+=/shadow_word_pain,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# TODO: Check Yshaarj Gains for pressing this during Inescapable Torment.
actions.aoe+=/shadow_word_death,target_if=min:target.time_to_die,if=target.time_to_die<=5&insanity<=80&talent.death_and_madness
actions.aoe+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.aoe+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.aoe+=/mindgames,if=spell_targets.mind_sear<5&dot.devouring_plague.ticking|talent.psychic_link
actions.aoe+=/void_torrent,if=insanity<=35&!talent.psychic_link,target_if=variable.dots_up
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&buff.surge_of_darkness.remains>=5,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler


actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# Todo Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=vts_applied,op=set,value=(active_dot.vampiric_touch+8*action.shadow_crash.in_flight)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

# Todo Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.filler=mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
actions.filler+=/vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/mind_spike,if=buff.surge_of_darkness.up
actions.filler+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=raid_event.adds.in>20
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
# Save up to 10s if adds are coming soon.
actions.filler+=/divine_star,if=raid_event.adds.in>10
actions.filler+=/mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
actions.filler+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.filler+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.filler+=/shadow_word_pain,target_if=min:remains

actions.main=call_action_list,name=main_variables
actions.main+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.main+=/mindbender,if=(variable.dots_up|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
actions.main+=/shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
actions.main+=/mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=!variable.holding_crash
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
actions.main+=/call_action_list,name=filler

actions.main_variables=variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions.main_variables+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions.main_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

actions.pl_torrent=void_bolt
actions.pl_torrent+=/vampiric_touch,if=remains<=6&cooldown.void_torrent.remains<gcd*2
actions.pl_torrent+=/devouring_plague,if=remains<=4&cooldown.void_torrent.remains<gcd*2&!buff.voidform.up&(spell_targets.mind_sear<=4|!talent.surge_of_darkness&cooldown.mind_blast.full_recharge_time>=3)&!buff.mind_devourer.up
actions.pl_torrent+=/mind_sear,if=!variable.dp_cutoff|buff.mind_devourer.up
actions.pl_torrent+=/mind_blast,if=!talent.mindgames|cooldown.mindgames.remains>=3&!prev_gcd.1.mind_blast
actions.pl_torrent+=/void_torrent,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking|buff.voidform.up
actions.pl_torrent+=/mindgames,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&dot.devouring_plague.ticking|buff.voidform.up

actions.trinkets=use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
# Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 45483 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45483.5 45483.5 43.4 / 0.096% 7594.0 / 16.7% 58.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
737.8 735.8 Mana 0.66% 52.4 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 45483
Elemental Blast 8052 17.7% 20.9 14.22sec 115360 99228 Direct 20.9 95039 191343 115403 21.1% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.92 20.92 0.00 0.00 0.00 1.1626 0.0000 2413816.65 2413816.65 0.00% 99227.85 99227.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.86% 16.49 7 27 95039.06 45563 209885 95065.59 74024 120357 1567566 1567566 0.00%
crit 21.14% 4.42 0 14 191343.15 91126 405122 189738.22 0 344742 846250 846250 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:10.49
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
    single
    [O]:1.24
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
    single
    [S]:9.19
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
Flame Shock 4735 10.4% 84.0 3.57sec 16900 129956 Direct 84.0 6117 12289 7186 17.3% 0.0%
Periodic 192.2 3612 7261 4246 17.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 84.00 84.00 192.18 192.18 83.00 0.1300 1.5511 1419511.52 1419511.52 0.00% 4593.87 129956.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 69.46 40 104 6117.44 3695 14041 6116.72 5340 7185 424921 424921 0.00%
crit 17.31% 14.54 2 33 12289.21 7391 28082 12288.04 9657 15959 178645 178645 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.64% 158.81 113 204 3612.27 1924 8027 3611.92 3200 4207 573674 573674 0.00%
crit 17.36% 33.37 12 60 7261.20 3903 15872 7260.87 6272 8903 242271 242271 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [X]:9.10
Flametongue Weapon 0 (925) 0.0% (2.0%) 1.0 0.00sec 277199 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 925 2.0% 676.7 0.72sec 410 0 Direct 676.7 349 700 410 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 676.69 676.69 0.00 0.00 0.00 0.0000 0.0000 277198.70 277198.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 559.12 394 729 348.57 289 593 348.56 322 386 194896 194896 0.00%
crit 17.37% 117.57 64 175 700.06 579 1186 700.10 637 787 82303 82303 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1099 2.4% 28.6 7.71sec 11523 0 Direct 28.6 9806 19717 11523 17.3% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.61 28.61 0.00 0.00 0.00 0.0000 0.0000 329720.90 329720.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 23.66 2 66 9806.24 9732 10030 9806.05 9732 10030 231996 231996 0.00%
crit 17.32% 4.96 0 19 19717.46 19463 20059 19340.81 0 20059 97725 97725 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5261 11.6% 39.8 7.51sec 39635 34173 Direct 39.8 33642 67691 39634 17.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.79 39.79 0.00 0.00 0.00 1.1598 0.0000 1577000.14 1577000.14 0.00% 34173.41 34173.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.40% 32.78 16 48 33641.69 7659 108134 33706.17 26154 42919 1102931 1102931 0.00%
crit 17.60% 7.00 0 19 67691.11 15318 211433 67843.01 0 147633 474069 474069 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [N]:35.42
  • if_expr:buff.hailstorm.up
    single
    [V]:4.37
Ice Strike 1885 4.1% 24.5 12.34sec 23028 19811 Direct 24.5 19595 39348 23028 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.53 24.53 0.00 0.00 0.00 1.1624 0.0000 564832.46 564832.46 0.00% 19811.04 19811.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 20.27 11 29 19595.18 15010 43377 19596.75 16862 23452 397116 397116 0.00%
crit 17.38% 4.26 0 14 39348.18 30020 83217 38866.56 0 82051 167717 167717 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:24.53
  • if_expr:talent.hailstorm.enabled
Lava Lash 9210 20.2% 68.0 4.36sec 40608 34880 Direct 68.0 (68.0) 34568 69371 40607 17.4% (17.4%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.97 67.97 0.00 0.00 0.00 1.1642 0.0000 2760122.53 2760122.53 0.00% 34880.42 34880.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 56.17 29 92 34567.81 17705 101960 34577.84 29861 41262 1941837 1941837 0.00%
crit 17.35% 11.80 1 26 69370.70 35409 231722 69395.68 50277 98817 818286 818286 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:50.15
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
    single
    [R]:17.82
Lightning Bolt 3319 7.3% 16.2 18.74sec 61288 51401 Direct 16.2 50420 101354 61289 21.3% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 0.00 0.00 0.00 1.1924 0.0000 994243.15 994243.15 0.00% 51400.67 51400.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.66% 12.76 4 23 50419.56 28816 129540 50560.17 36967 69014 643393 643393 0.00%
crit 21.34% 3.46 0 10 101353.72 57633 259941 99425.43 0 220725 350850 350850 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:7.00
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [P]:0.27
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [T]:8.96
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1732 3.8% 193.4 1.81sec 2686 1508 Direct 193.4 2654 5331 2686 17.4% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.35 193.35 0.00 0.00 0.00 1.7811 0.0000 519254.63 741811.25 30.00% 1507.76 1507.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.30% 128.19 83 180 2654.21 2257 4290 2654.11 2443 2925 340248 486080 30.00%
crit 17.37% 33.58 11 61 5331.35 4513 8580 5330.89 4750 6023 179007 255731 30.00%
miss 16.33% 31.58 10 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 867 1.9% 193.4 1.80sec 1345 755 Direct 193.4 1329 2671 1345 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.37 193.37 0.00 0.00 0.00 1.7814 0.0000 260039.01 371493.77 30.00% 754.88 754.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.26% 128.14 85 180 1328.62 1128 2145 1328.59 1223 1482 170246 243215 30.00%
crit 17.39% 33.62 14 57 2670.86 2257 4290 2670.37 2376 3050 89793 128279 30.00%
miss 16.35% 31.62 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 162 (2857) 0.4% (6.3%) 7.0 45.70sec 121701 102182 Direct 7.0 (14.0) 5898 11846 6916 17.1% (19.2%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1912 0.0000 48612.85 48612.85 0.00% 102181.84 102181.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.89% 5.83 1 8 5897.84 4707 9102 5900.75 4707 7566 34364 34364 0.00%
crit 17.11% 1.20 0 7 11845.95 9413 18203 8645.22 0 18029 14249 14249 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2695 5.9% 7.0 45.88sec 115370 0 Direct 7.0 95142 190022 115376 21.3% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 0.0000 0.0000 807160.07 807160.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.68% 5.50 1 8 95141.50 67238 194956 95203.66 68267 141636 523695 523695 0.00%
crit 21.32% 1.49 0 6 190021.74 134477 374463 153345.89 0 370611 283465 283465 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1954) 0.0% (4.3%) 51.6 5.75sec 11358 9711

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.59 0.00 0.00 0.00 0.00 1.1695 0.0000 0.00 0.00 0.00% 9711.35 9711.35

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [Q]:51.59
    Stormstrike (_mh) 1302 2.9% 51.6 5.75sec 7570 0 Direct 51.6 6443 12954 7570 17.3% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.59 51.59 0.00 0.00 0.00 0.0000 0.0000 390493.38 557861.92 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 42.66 21 65 6443.36 5465 10690 6442.69 5794 7174 274882 392699 30.00%
crit 17.30% 8.92 0 24 12953.63 10930 21381 12943.31 0 16925 115611 165163 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 652 1.4% 51.6 5.75sec 3788 0 Direct 51.6 3221 6481 3788 17.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.59 51.59 0.00 0.00 0.00 0.0000 0.0000 195411.65 279166.62 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 42.62 20 66 3221.29 2733 5345 3220.78 2920 3601 137280 196119 30.00%
crit 17.39% 8.97 0 23 6480.77 5465 10690 6479.28 0 9097 58132 83048 29.99%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 778 1.7% 5.7 53.70sec 40708 35041 Direct 5.7 34564 69662 40707 17.5% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.73 5.73 0.00 0.00 0.00 1.1617 0.0000 233335.10 233335.10 0.00% 35040.56 35040.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.50% 4.73 1 8 34564.27 26685 70992 34552.70 26685 49231 163441 163441 0.00%
crit 17.50% 1.00 0 5 69661.64 53369 141155 46129.86 0 141155 69894 69894 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [U]:5.73
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (715) 0.0% (1.6%) 1.0 0.00sec 214358 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 715 1.6% 151.8 4.06sec 1412 0 Direct 151.8 1202 2415 1412 17.4% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 151.76 151.76 0.00 0.00 0.00 0.0000 0.0000 214358.01 306233.53 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 125.39 58 188 1201.68 1016 1988 1201.59 1079 1344 150680 215262 30.00%
crit 17.38% 26.37 6 55 2414.91 2032 3976 2414.24 2110 2978 63678 90972 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 413 / 86
melee 413 0.2% 40.0 2.25sec 640 420 Direct 40.0 545 1089 640 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.00 40.00 0.00 0.00 0.00 1.5239 0.0000 25583.11 36548.24 30.00% 419.66 419.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 33.04 16 63 544.76 475 908 543.76 475 685 17999 25713 30.00%
crit 17.41% 6.96 0 19 1089.07 950 1774 1086.31 0 1469 7585 10835 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2298 / 670
melee 2298 1.5% 89.3 3.41sec 2248 1998 Direct 89.3 1915 3827 2248 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.32 89.32 0.00 0.00 0.00 1.1251 0.0000 200769.88 286821.43 30.00% 1997.83 1997.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 73.80 6 175 1915.28 1588 3071 1912.76 1588 2394 141340 201919 30.00%
crit 17.38% 15.53 0 45 3827.23 3176 6141 3820.68 0 4994 59430 84902 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2297 / 672
melee 2297 1.5% 89.5 3.40sec 2246 1995 Direct 89.5 1913 3824 2246 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.54 89.54 0.00 0.00 0.00 1.1258 0.0000 201111.97 287310.14 30.00% 1995.18 1995.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 73.94 7 171 1913.28 1588 3071 1910.38 1588 2545 141468 202102 30.00%
crit 17.42% 15.60 0 46 3824.25 3176 6141 3815.55 0 5199 59644 85208 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2292 / 669
melee 2292 1.5% 89.1 3.41sec 2245 1992 Direct 89.1 1913 3821 2245 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.12 89.12 0.00 0.00 0.00 1.1271 0.0000 200105.97 285872.96 30.00% 1992.08 1992.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 73.60 2 166 1912.93 1588 3071 1910.68 1588 2603 140787 201129 30.00%
crit 17.42% 15.53 0 49 3820.69 3176 6141 3815.98 0 5720 59319 84744 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 310.10sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0219 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [W]:1.12
Feral Spirit 10.7 30.05sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 0.00 0.00 0.00 1.1802 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.73
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.29sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.49
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 67.5 124.6 4.4sec 1.6sec 3.6sec 81.41% 98.20% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.5s

Stack Uptimes

  • ashen_catalyst_1:31.52%
  • ashen_catalyst_2:16.73%
  • ashen_catalyst_3:12.08%
  • ashen_catalyst_4:9.84%
  • ashen_catalyst_5:6.13%
  • ashen_catalyst_6:3.09%
  • ashen_catalyst_7:1.59%
  • ashen_catalyst_8:0.44%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 5.9 0.0 48.3sec 48.3sec 14.7sec 29.16% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 296.7s
  • trigger_min/max:14.0s / 296.7s
  • trigger_pct:84.95%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crackling_surge_1:23.33%
  • crackling_surge_2:5.83%
  • crackling_surge_3:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 165.0s
  • trigger_pct:100.00%
  • duration_min/max:16.2s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.58%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.78%
  • crumbling_power_18:0.83%
  • crumbling_power_19:1.00%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 6.2 0.8 44.7sec 38.7sec 10.7sec 22.04% 0.00% 0.8 (0.8) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 281.9s
  • trigger_min/max:1.6s / 274.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.2s

Stack Uptimes

  • elemental_blast_critical_strike_1:22.04%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.1 0.9 45.4sec 38.7sec 10.8sec 21.97% 0.00% 0.9 (0.9) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 314.2s
  • trigger_min/max:1.6s / 309.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.1s

Stack Uptimes

  • elemental_blast_haste_1:21.97%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.1 0.8 44.9sec 38.8sec 10.7sec 21.95% 0.00% 0.8 (0.8) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 286.2s
  • trigger_min/max:1.6s / 286.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.1s

Stack Uptimes

  • elemental_blast_mastery_1:21.95%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 122.8sec 98.0sec 57.9sec 25.00% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:25.00%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 125.1sec 99.7sec 58.3sec 25.02% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 343.8s

Stack Uptimes

  • elemental_chaos_earth_1:25.02%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 122.9sec 99.1sec 58.1sec 25.01% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.01%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.1sec 98.8sec 58.0sec 24.97% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.97%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.3sec 302.3sec 27.5sec 13.37% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 324.7s
  • trigger_min/max:300.0s / 324.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.37%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 0.0 29.2sec 30.0sec 14.7sec 52.55% 0.00% 42.0 (42.0) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 48.8s
  • trigger_min/max:16.3s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • feral_spirit_1:52.55%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 49.7 230.9 6.1sec 1.1sec 4.8sec 78.93% 87.93% 230.9 (498.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 58.5s
  • trigger_min/max:0.0s / 20.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.3s

Stack Uptimes

  • flurry_1:21.77%
  • flurry_2:34.26%
  • flurry_3:22.89%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4sec 46.3sec 13.0sec 19.52% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 213.8s
  • trigger_min/max:0.2s / 213.8s
  • trigger_pct:98.90%
  • duration_min/max:0.0s / 49.9s

Stack Uptimes

  • forgestorm_ignited_1:19.52%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 35.7 1.5 8.4sec 8.1sec 2.2sec 26.01% 89.12% 1.5 (10.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 34.1s
  • trigger_min/max:1.2s / 34.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.1s

Stack Uptimes

  • hailstorm_5:4.74%
  • hailstorm_6:3.42%
  • hailstorm_7:2.67%
  • hailstorm_8:4.41%
  • hailstorm_9:2.56%
  • hailstorm_10:8.21%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.6 27.6sec 17.6sec 9.9sec 35.15% 88.63% 5.6 (5.6) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 226.5s
  • trigger_min/max:0.0s / 226.5s
  • trigger_pct:5.02%
  • duration_min/max:0.0s / 53.4s

Stack Uptimes

  • hot_hand_1:35.15%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.5 0.0 12.4sec 12.3sec 3.9sec 32.23% 60.28% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 27.0s
  • trigger_min/max:7.7s / 26.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.8s

Stack Uptimes

  • ice_strike_1:32.23%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.17% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 312.5s
  • trigger_min/max:13.5s / 312.5s
  • trigger_pct:85.03%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • icy_edge_1:23.36%
  • icy_edge_2:5.81%
  • icy_edge_3:0.00%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 38.0 227.6 8.0sec 2.3sec 6.9sec 87.42% 100.00% 16.9 (37.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 33.7s
  • trigger_min/max:0.0s / 17.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.9s

Stack Uptimes

  • maelstrom_weapon_1:11.11%
  • maelstrom_weapon_2:12.85%
  • maelstrom_weapon_3:13.19%
  • maelstrom_weapon_4:13.22%
  • maelstrom_weapon_5:10.14%
  • maelstrom_weapon_6:8.03%
  • maelstrom_weapon_7:6.22%
  • maelstrom_weapon_8:4.10%
  • maelstrom_weapon_9:2.30%
  • maelstrom_weapon_10:6.27%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.0 0.0 48.3sec 48.2sec 14.7sec 29.23% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 297.9s
  • trigger_min/max:13.1s / 297.9s
  • trigger_pct:84.86%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • molten_weapon_1:23.35%
  • molten_weapon_2:5.88%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.58% 43.69% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 52.2s
  • trigger_min/max:45.0s / 52.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.9s

Stack Uptimes

  • primordial_wave_1:4.58%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 61.0sec 45.8sec 16.5sec 23.63% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 232.1s
  • trigger_min/max:0.0s / 216.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.3s

Stack Uptimes

  • sophic_devotion_1:23.63%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.1sec 45.8sec 32.1sec 38.19% 0.00% 25.6 (25.6) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 294.4s
  • trigger_min/max:0.0s / 208.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 217.8s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.69%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.60% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:38.2s / 53.7s
  • trigger_min/max:38.2s / 53.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.60%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 30.7 8.8 9.6sec 7.4sec 2.9sec 29.21% 58.31% 8.8 (8.8) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 113.0s
  • trigger_min/max:0.0s / 113.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.8s

Stack Uptimes

  • stormbringer_1:29.21%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.9 11.0 50.0 10.9s 1.1s 128.9s
windfury_totem_extra_attack_oh 26.9 8.0 50.0 10.9s 1.1s 130.0s
Maelstrom Weapon: Feral Spirit 63.0 47.0 80.0 4.8s 0.0s 32.3s
Maelstrom Weapon: Swirling Maelstrom 59.9 43.0 80.0 5.0s 0.8s 24.2s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 52.2s
Maelstrom Weapon: Windfury Attack 30.4 11.0 57.0 10.8s 0.0s 129.7s
Maelstrom Weapon: main_hand 32.4 14.0 57.0 9.4s 1.1s 119.8s
Maelstrom Weapon: offhand 32.4 14.0 60.0 9.4s 1.1s 112.9s
Maelstrom Weapon: Sundering 1.1 0.0 5.0 107.4s 40.0s 342.3s
Maelstrom Weapon: Lava Lash 13.6 2.0 32.0 20.6s 0.8s 257.3s
Maelstrom Weapon: Ice Strike 4.9 0.0 14.0 50.3s 7.7s 321.6s
Maelstrom Weapon: Stormstrike 10.4 1.0 24.0 26.6s 0.8s 243.8s
Maelstrom Weapon: Stormstrike Off-Hand 10.4 0.0 23.0 26.5s 0.8s 265.7s
Flametongue: Windfury Attack 151.8 80.0 230.0 4.1s 0.0s 55.5s
Stormbringer: Windfury Attack 16.9 3.0 36.0 17.9s 0.0s 188.1s
Flametongue: main_hand 161.8 113.0 215.0 2.2s 1.1s 16.7s
Hot Hand: main_hand 8.1 0.0 21.0 32.9s 1.1s 296.3s
Windfury: main_hand 50.4 21.0 83.0 6.2s 1.1s 75.3s
Flametongue: offhand 161.8 113.0 217.0 2.2s 1.1s 18.7s
Hot Hand: offhand 8.1 0.0 21.0 32.9s 1.1s 277.0s
Flametongue: Sundering 5.7 2.0 8.0 53.7s 40.0s 209.9s
Stormbringer: Sundering 0.6 0.0 5.0 114.4s 40.0s 332.3s
Windfury: Sundering 1.8 0.0 6.0 97.7s 40.0s 342.1s
Flametongue: Lava Lash 68.0 37.0 107.0 4.4s 0.8s 15.5s
Stormbringer: Lava Lash 7.6 0.0 19.0 34.2s 0.8s 312.0s
Flametongue: Ice Strike 24.5 19.0 30.0 12.3s 7.7s 26.5s
Stormbringer: Ice Strike 2.7 0.0 11.0 70.1s 7.7s 327.1s
Windfury: Ice Strike 7.6 0.0 19.0 36.1s 7.7s 279.2s
Flametongue: Stormstrike 51.6 31.0 76.0 5.7s 0.8s 37.4s
Stormbringer: Stormstrike 5.7 0.0 16.0 41.7s 0.8s 312.6s
Windfury: Stormstrike 16.0 3.0 33.0 17.8s 0.8s 182.1s
Flametongue: Stormstrike Off-Hand 51.6 31.0 76.0 5.7s 0.8s 37.4s
Stormbringer: Stormstrike Off-Hand 5.8 0.0 19.0 41.6s 0.8s 324.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.24% 13.26% 30.36% 0.5s 0.0s 4.5s
Hot Hand 35.15% 8.00% 61.70% 9.9s 0.0s 53.4s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8520.0011.5287.6182.18213.475
Sundering14.2350.002169.93864.9381.888185.831
Primordial Wave0.8830.0017.2244.2820.00014.379
Lava Lash0.8810.00111.64957.76325.43493.271
Flame Shock22.7100.001241.269181.4710.000294.789
Ice Strike0.7890.00113.82916.0242.06744.010
Frost Shock3.0070.00126.503110.91657.352168.589
Elemental Blast5.5050.00138.56047.9614.943132.469
Stormstrike1.9750.00128.84394.84441.501157.433
Earth Elemental10.4340.00849.1391.2090.00049.139

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana624.34220741.35100.00%353.56258638.9153.95%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 735.81 737.79 258638.5 49403.6 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 20.9228771.251375.001375.0383.90
Flame ShockMana 9.106822.59750.0081.22208.06
Frost ShockMana 39.7919894.01500.00500.0079.27
Ice StrikeMana 24.5340471.961650.001650.0113.96
Lava LashMana 67.9727188.43400.00400.00101.52
Lightning BoltMana 16.228111.25500.00500.00122.58
Primordial WaveMana 7.0310547.591500.001500.0081.13
StormstrikeMana 51.5951585.261000.00999.9811.36
SunderingMana 5.7317195.713000.002999.9713.57

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 45483.49
Minimum 39484.73
Maximum 54016.50
Spread ( max - min ) 14531.77
Range [ ( max - min ) / 2 * 100% ] 15.97%
Standard Deviation 1919.3510
5th Percentile 42423.72
95th Percentile 48722.41
( 95th Percentile - 5th Percentile ) 6298.69
Mean Distribution
Standard Deviation 22.1642
95.00% Confidence Interval ( 45440.05 - 45526.93 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 69
0.1% Error 6841
0.1 Scale Factor Error with Delta=300 31448
0.05 Scale Factor Error with Delta=300 125792
0.01 Scale Factor Error with Delta=300 3144797
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 45483.49
Minimum 39484.73
Maximum 54016.50
Spread ( max - min ) 14531.77
Range [ ( max - min ) / 2 * 100% ] 15.97%
Standard Deviation 1919.3510
5th Percentile 42423.72
95th Percentile 48722.41
( 95th Percentile - 5th Percentile ) 6298.69
Mean Distribution
Standard Deviation 22.1642
95.00% Confidence Interval ( 45440.05 - 45526.93 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 69
0.1% Error 6841
0.1 Scale Factor Error with Delta=300 31448
0.05 Scale Factor Error with Delta=300 125792
0.01 Scale Factor Error with Delta=300 3144797
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 45483.49
Minimum 39484.73
Maximum 54016.50
Spread ( max - min ) 14531.77
Range [ ( max - min ) / 2 * 100% ] 15.97%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13005110.76
Minimum 9052288.60
Maximum 17091071.43
Spread ( max - min ) 8038782.83
Range [ ( max - min ) / 2 * 100% ] 30.91%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.49 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.73 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 50.15 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
0.00 ice_strike,if=buff.doom_winds.up
0.00 sundering,if=buff.doom_winds.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 7.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 10.49 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
M 24.53 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
N 35.42 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
O 1.24 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
P 0.27 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
Q 51.59 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
R 17.82 lava_lash
S 9.19 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
T 8.96 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 5.73 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
V 4.37 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
W 1.12 earth_elemental
X 9.10 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKMINIQILINIMQLNQQRTNIMFIQISINQTMNRQSNIQITIMINQJFKNQRMIQISINIQQMQONRUIQIQIMITNFQIQIJIIKIMINIQILINIMFILNQIQIQILMNIQITINQUJFIKIIMINIQIQILIMNQTWNRQSNMIQIIQFILDEIMJKNQRUSNQMRTNQFIQIQILIMNQSXNRIQIMIQITJFKNQMQRSNUQSNIMIQITNRQXVMQRFLNQXRMSJKNQRQIQIMIOFINIQILIMI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_frost
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, crumbling_power(20), elemental_chaos_frost
0:00.893 default B potion Fluffy_Pillow 40678.8/50000: 81% mana bloodlust, berserking, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon, crumbling_power(19), elemental_chaos_frost
0:00.893 single J primordial_wave Fluffy_Pillow 40678.8/50000: 81% mana bloodlust, berserking, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon, crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:01.789 single K lightning_bolt Fluffy_Pillow 40612.4/50000: 81% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(10), crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:02.683 single M ice_strike Fluffy_Pillow 41542.8/50000: 83% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon, hailstorm(10), crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.497 single I lava_lash Fluffy_Pillow 41195.2/50000: 82% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(17), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:04.311 single N frost_shock Fluffy_Pillow 42097.6/50000: 84% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(16), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.124 single I lava_lash Fluffy_Pillow 42898.4/50000: 86% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(15), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.937 single Q stormstrike Fluffy_Pillow 43799.2/50000: 88% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(14), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.750 single I lava_lash Fluffy_Pillow 44100.0/50000: 88% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), crumbling_power(13), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.565 single L elemental_blast Fluffy_Pillow 45004.0/50000: 90% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(8), crumbling_power(12), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.378 single I lava_lash Fluffy_Pillow 44929.8/50000: 90% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(8), crumbling_power(11), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.191 single N frost_shock Fluffy_Pillow 45830.6/50000: 92% mana bloodlust, berserking, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), crumbling_power(10), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.004 single I lava_lash Fluffy_Pillow 46631.4/50000: 93% mana bloodlust, berserking, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), crumbling_power(9), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.820 single M ice_strike Fluffy_Pillow 47537.0/50000: 95% mana bloodlust, berserking, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(3), crumbling_power(8), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.635 single Q stormstrike Fluffy_Pillow 47191.0/50000: 94% mana bloodlust, berserking, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(5), ice_strike, crumbling_power(7), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.449 single L elemental_blast Fluffy_Pillow 47493.4/50000: 95% mana bloodlust, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(8), ice_strike, crumbling_power(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.344 single N frost_shock Fluffy_Pillow 47550.4/50000: 95% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, crumbling_power(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.238 single Q stormstrike Fluffy_Pillow 48480.8/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(3), crumbling_power(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.222 single Q stormstrike Fluffy_Pillow 49055.2/50000: 98% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(4), stormbringer, maelstrom_weapon(5), crumbling_power(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.207 single R lava_lash Fluffy_Pillow 49631.2/50000: 99% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(5), crumbling_power(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.190 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(5), crumbling_power, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.173 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), hailstorm(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.158 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), spiraling_winds, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.143 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(2), spiraling_winds, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.169 default F feral_spirit Fluffy_Pillow 49921.2/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), ice_strike, spiraling_winds(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.151 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, maelstrom_weapon(4), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.134 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(4), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.118 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.101 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.084 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(6), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.068 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon, hailstorm(6), ice_strike, spiraling_winds(5), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.053 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(5), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.038 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(6), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.022 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(6), spiraling_winds(6), forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:31.006 single N frost_shock Fluffy_Pillow 49924.4/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(6), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_frost
0:31.991 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(7), forgestorm_ignited, elemental_chaos_frost
0:32.976 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
0:33.960 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
0:34.944 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, hailstorm(6), spiraling_winds(9), elemental_chaos_frost
0:35.928 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(2), spiraling_winds(9), elemental_chaos_frost
0:36.913 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), spiraling_winds(9), elemental_chaos_frost
0:37.899 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
0:38.883 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, hot_hand, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_frost
0:39.868 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(5), spiraling_winds(10), elemental_chaos_frost
0:40.853 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(5), spiraling_winds(10), elemental_chaos_frost
0:42.129 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:43.409 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(5), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:44.686 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(6), elemental_chaos_frost
0:45.964 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), maelstrom_weapon(10), elemental_chaos_frost
0:47.242 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(3), maelstrom_weapon(10), elemental_chaos_frost
0:48.520 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(10), elemental_chaos_frost
0:49.798 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), hailstorm(10), elemental_chaos_frost
0:50.961 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(2), elemental_chaos_frost
0:52.122 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(6), maelstrom_weapon(2), elemental_chaos_frost
0:53.284 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), maelstrom_weapon(3), elemental_chaos_frost
0:54.444 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), ice_strike, elemental_chaos_frost
0:55.606 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_frost
0:56.769 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), ice_strike, elemental_chaos_frost
0:57.930 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(7), ice_strike, elemental_chaos_frost
0:59.091 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, hailstorm(7), ice_strike, elemental_chaos_frost
1:00.251 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), ice_strike, elemental_chaos_fire
1:01.411 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(3), elemental_chaos_fire
1:02.689 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, maelstrom_weapon(5), elemental_chaos_fire
1:03.964 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, stormbringer, maelstrom_weapon(6), elemental_chaos_fire
1:05.241 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), elemental_chaos_fire
1:06.573 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(9), ice_strike, elemental_chaos_fire
1:07.851 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:09.127 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(4), hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_fire
1:10.404 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
1:11.681 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
1:12.957 single I lava_lash Fluffy_Pillow 49041.6/50000: 98% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
1:14.237 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
1:15.516 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
1:16.793 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
1:18.071 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
1:19.347 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
1:20.625 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_fire
1:21.903 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_fire
1:23.181 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon, hailstorm(7), ice_strike, elemental_chaos_fire
1:24.460 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(2), elemental_chaos_fire
1:25.736 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_fire
1:27.014 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(5), elemental_chaos_fire
1:28.292 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_fire
1:29.571 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_fire
1:30.847 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), elemental_chaos_fire
1:32.242 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_fire
1:33.519 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_fire
1:34.797 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_fire
1:36.074 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(10), forgestorm_ignited, elemental_chaos_fire
1:37.236 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), forgestorm_ignited, elemental_chaos_fire
1:38.397 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:39.560 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:40.723 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_fire
1:41.885 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_fire
1:43.046 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_fire
1:44.208 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, hot_hand, stormbringer, maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_fire
1:45.368 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), forgestorm_ignited, elemental_chaos_fire
1:46.528 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(8), elemental_chaos_fire
1:47.689 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_fire
1:48.966 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_fire
1:50.289 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_fire
1:51.565 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
1:52.844 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:54.122 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, elemental_chaos_fire
1:55.362 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), elemental_chaos_fire
1:56.603 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(4), elemental_chaos_fire
1:57.844 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), elemental_chaos_fire
1:59.085 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), elemental_chaos_fire
2:00.323 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_earth
2:01.565 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), elemental_chaos_earth
2:02.804 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), elemental_chaos_earth
2:04.044 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, hailstorm(9), elemental_chaos_earth
2:05.321 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), hailstorm(9), ice_strike, elemental_chaos_earth
2:06.599 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_earth
2:07.877 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_earth
2:09.155 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(6), elemental_chaos_earth
2:10.433 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_chaos_earth
2:11.711 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, hailstorm(7), elemental_chaos_earth
2:12.989 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, hailstorm(7), elemental_chaos_earth
2:14.268 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon, elemental_chaos_earth
2:15.546 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_earth
2:16.822 single J primordial_wave Fluffy_Pillow 49041.6/50000: 98% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_earth
2:18.100 default F feral_spirit Fluffy_Pillow 49586.4/50000: 99% mana flurry, primordial_wave, ashen_catalyst(4), hot_hand, maelstrom_weapon(10), elemental_chaos_earth
2:19.379 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hot_hand, maelstrom_weapon(10), elemental_chaos_earth
2:20.657 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(10), elemental_chaos_earth
2:21.934 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), elemental_chaos_earth
2:23.095 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), elemental_chaos_earth
2:24.258 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), elemental_chaos_earth
2:25.419 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_chaos_earth
2:26.581 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_chaos_earth
2:27.743 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_earth
2:28.903 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_earth
2:30.066 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_earth
2:31.227 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_earth
2:32.388 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_earth
2:33.551 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), elemental_chaos_earth
2:34.829 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), elemental_chaos_earth
2:36.070 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(8), elemental_chaos_earth
2:37.315 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), hailstorm(8), ice_strike, elemental_chaos_earth
2:38.557 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), elemental_chaos_earth
2:39.798 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(6), elemental_chaos_earth
2:41.038 single W earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon, hailstorm(6), elemental_chaos_earth
2:42.277 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon, hailstorm(6), elemental_chaos_earth
2:43.519 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon(5), elemental_chaos_earth
2:44.759 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(5), elemental_chaos_earth
2:46.052 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(5), elemental_chaos_earth
2:47.329 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon, hailstorm(5), elemental_chaos_earth
2:48.611 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_earth
2:49.890 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), hot_hand, maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:51.168 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:52.446 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:53.722 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:55.000 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:56.278 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_earth
2:57.555 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
2:58.831 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, elemental_chaos_earth
3:00.107 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(9), ice_strike, elemental_chaos_earth
3:00.107 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(9), ice_strike, crumbling_power(20), elemental_chaos_earth
3:00.107 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(9), ice_strike, crumbling_power(20), elemental_chaos_earth
3:01.267 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(9), crumbling_power(19), elemental_chaos_earth
3:02.429 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), hailstorm(9), ice_strike, crumbling_power(18), elemental_chaos_earth
3:03.590 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(10), hailstorm(9), ice_strike, crumbling_power(18), elemental_chaos_earth
3:04.751 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, hailstorm(10), ice_strike, crumbling_power(17), elemental_chaos_earth
3:05.808 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), crumbling_power(16), elemental_chaos_earth
3:06.867 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), crumbling_power(15), elemental_chaos_earth
3:07.923 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(3), crumbling_power(14), elemental_chaos_earth
3:08.979 single S elemental_blast Fluffy_Pillow 48689.6/50000: 97% mana berserking, flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(5), crumbling_power(13), spiraling_winds, elemental_chaos_earth
3:10.038 single N frost_shock Fluffy_Pillow 49009.0/50000: 98% mana berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hailstorm(5), crumbling_power(12), spiraling_winds(2), elemental_chaos_earth
3:11.094 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon, crumbling_power(11), spiraling_winds(2), elemental_chaos_earth
3:12.149 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst(4), maelstrom_weapon(4), crumbling_power(10), spiraling_winds(3), elemental_chaos_earth
3:13.314 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, ashen_catalyst(5), maelstrom_weapon(6), ice_strike, crumbling_power(9), spiraling_winds(3), elemental_chaos_earth
3:14.476 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, maelstrom_weapon(8), ice_strike, crumbling_power(8), spiraling_winds(4), elemental_chaos_earth
3:15.637 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, hailstorm(8), ice_strike, crumbling_power(7), spiraling_winds(4), elemental_chaos_earth
3:16.914 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon, crumbling_power(6), spiraling_winds(5), elemental_chaos_earth
3:18.191 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), crumbling_power(5), spiraling_winds(6), elemental_chaos_earth
3:19.555 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(3), crumbling_power(4), spiraling_winds(7), elemental_chaos_earth
3:20.833 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(7), elemental_chaos_earth
3:22.110 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), spiraling_winds(8), elemental_chaos_earth
3:23.385 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), spiraling_winds(8), sophic_devotion, elemental_chaos_earth
3:24.663 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(9), spiraling_winds(9), sophic_devotion, elemental_chaos_earth
3:25.938 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:27.215 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, hailstorm(10), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:28.494 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon, hailstorm(10), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:29.771 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:31.049 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:32.326 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:33.604 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:34.884 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:36.162 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:37.438 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_earth
3:38.715 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_earth
3:39.994 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_earth
3:41.271 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_earth
3:42.548 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(10), elemental_chaos_earth
3:43.825 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
3:45.101 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
3:46.378 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
3:47.655 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hailstorm(9), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
3:48.931 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(3), maelstrom_weapon(10), hailstorm(9), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
3:50.207 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(10), hailstorm(9), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
3:51.485 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
3:52.646 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_earth
3:53.806 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
3:54.967 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(7), stormbringer, maelstrom_weapon(7), ice_strike, forgestorm_ignited, elemental_chaos_earth
3:56.129 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(7), maelstrom_weapon(7), ice_strike, elemental_chaos_earth
3:57.290 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(7), ice_strike, elemental_chaos_earth
3:58.450 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon, hailstorm(7), ice_strike, elemental_chaos_earth
3:59.578 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_earth
4:00.704 single Q stormstrike Fluffy_Pillow 48801.6/50000: 98% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_frost
4:01.832 single S elemental_blast Fluffy_Pillow 49606.4/50000: 99% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(5), elemental_chaos_frost
4:02.959 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(5), hailstorm(5), elemental_chaos_frost
4:04.259 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(6), hot_hand, maelstrom_weapon(2), elemental_chaos_frost
4:05.501 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, hot_hand, maelstrom_weapon(3), elemental_chaos_frost
4:06.744 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, elemental_chaos_frost
4:07.984 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, elemental_chaos_frost
4:09.263 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(9), ice_strike, elemental_chaos_frost
4:10.542 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, hot_hand, maelstrom_weapon(9), ice_strike, elemental_chaos_frost
4:11.819 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon, hailstorm(9), ice_strike, elemental_chaos_frost
4:13.098 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(2), elemental_chaos_frost
4:14.375 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(2), elemental_chaos_frost
4:15.653 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, maelstrom_weapon(2), elemental_chaos_frost
4:16.929 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(2), elemental_chaos_frost
4:18.206 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_frost
4:19.484 Waiting     1.080 sec 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(4), ice_strike, elemental_chaos_frost
4:20.564 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(4), ice_strike, elemental_chaos_frost
4:22.019 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(6), ice_strike, elemental_chaos_frost
4:23.296 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_frost
4:24.572 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_frost
4:25.851 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, hailstorm(8), ice_strike, elemental_chaos_frost
4:27.128 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(3), elemental_chaos_frost
4:28.405 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(3), elemental_chaos_frost
4:29.683 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(4), elemental_chaos_frost
4:30.985 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
4:32.262 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_frost
4:33.540 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(2), hailstorm(5), ice_strike, sophic_devotion, elemental_chaos_frost
4:34.818 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(10), hailstorm(5), ice_strike, sophic_devotion, elemental_chaos_frost
4:36.096 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_frost
4:37.256 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost
4:38.417 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst(5), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
4:39.579 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(5), sophic_devotion, elemental_chaos_frost
4:40.741 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), sophic_devotion, elemental_chaos_frost
4:41.902 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion, elemental_chaos_frost
4:43.064 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), sophic_devotion, elemental_chaos_frost
4:44.226 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(8), sophic_devotion, elemental_chaos_frost
4:45.389 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
4:46.550 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
4:47.713 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_frost
4:48.989 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_frost
4:50.266 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_frost
4:51.546 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion, elemental_chaos_frost
4:52.822 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion, elemental_chaos_frost
4:54.099 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(9), sophic_devotion, elemental_chaos_frost
4:55.375 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(9), sophic_devotion, elemental_chaos_frost
4:56.654 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(9), sophic_devotion, elemental_chaos_frost
4:57.895 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(9), forgestorm_ignited, elemental_chaos_frost
4:59.134 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(9), ice_strike, forgestorm_ignited, elemental_chaos_frost

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.79% 17.79% 3025
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.70% 58.70% 3843
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [31]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3025
# gear_mastery_rating=3843
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 47012 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
47012.5 47012.5 86.9 / 0.185% 15268.9 / 32.5% 52.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
843.6 840.9 Mana 1.44% 52.3 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 47012
Ascendance (_dre) 0 (1027) 0.0% (2.2%) 8.4 30.91sec 36747 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.37 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1027 2.2% 8.4 30.91sec 36747 0 Direct 8.4 30754 61821 36747 19.3% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.37 8.37 0.00 0.00 0.00 0.0000 0.0000 307703.01 307703.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 6.76 0 20 30754.21 25297 51599 30681.40 0 44076 207847 207847 0.00%
crit 19.29% 1.62 0 9 61820.61 50593 102873 48453.26 0 102873 99856 99856 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 78 0.2% 3.7 90.41sec 6206 5672 Direct 3.7 6206 0 6206 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0943 0.0000 23158.68 33084.67 30.00% 5671.98 5671.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6205.92 3670 13032 6221.82 4865 8635 23159 33085 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6960 14.8% 25.1 11.75sec 83061 70733 Direct 25.1 68620 137579 83090 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.14 25.13 0.00 0.00 0.00 1.1743 0.0000 2087752.89 2087752.89 0.00% 70732.92 70732.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.01% 19.85 10 29 68619.66 43658 135351 68620.09 56616 82441 1362306 1362306 0.00%
crit 20.99% 5.27 0 15 137579.20 87317 266996 136872.38 0 231600 725447 725447 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.14
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1504 3.2% 29.8 9.87sec 15119 34484 Direct 29.8 2733 5486 3213 17.4% 0.0%
Periodic 186.8 1619 3253 1902 17.3% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.84 29.84 186.83 186.83 28.54 0.4384 1.5557 451225.53 451225.53 0.00% 1485.59 34484.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 24.64 12 42 2733.12 2272 4687 2733.12 2411 3180 67357 67357 0.00%
crit 17.42% 5.20 0 16 5485.65 4543 9374 5447.74 0 8078 28526 28526 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.69% 154.49 105 202 1619.17 1 2756 1618.95 1479 1818 250142 250142 0.00%
crit 17.31% 32.34 9 57 3252.82 10 5513 3252.37 2849 3729 105201 105201 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.31
  • if_expr:!ticking
    single
    [Z]:10.01
Flametongue Weapon 0 (1502) 0.0% (3.2%) 1.0 0.00sec 450170 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1502 3.2% 1129.6 0.67sec 399 0 Direct 1129.6 339 681 399 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1129.60 1129.60 0.00 0.00 0.00 0.0000 0.0000 450170.20 450170.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 934.18 641 1265 339.40 277 570 339.45 312 380 317056 317056 0.00%
crit 17.30% 195.42 113 289 681.16 555 1140 681.32 611 777 133114 133114 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1109 2.4% 28.8 7.66sec 11541 0 Direct 28.8 9807 19718 11541 17.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.82 28.82 0.00 0.00 0.00 0.0000 0.0000 332637.02 332637.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.50% 23.78 1 65 9807.06 9732 10030 9807.10 9732 10030 233207 233207 0.00%
crit 17.50% 5.04 0 20 19717.60 19463 20059 19367.79 0 20059 99430 99430 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1012 2.2% 16.5 16.92sec 18429 15737 Direct 16.5 15653 31495 18430 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.00 1.1711 0.0000 303638.74 303638.74 0.00% 15736.65 15736.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 13.59 3 31 15652.53 7339 30286 15714.09 12073 20616 212692 212692 0.00%
crit 17.53% 2.89 0 12 31494.92 14678 59196 29816.41 0 57706 90947 90947 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:16.48
Ice Strike 1383 2.9% 20.2 14.97sec 20565 17755 Direct 20.2 17517 35161 20565 17.3% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.00 1.1583 0.0000 414500.07 414500.07 0.00% 17754.65 17754.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 16.67 7 26 17517.25 14383 29677 17518.58 15416 20059 292077 292077 0.00%
crit 17.27% 3.48 0 11 35160.82 28765 58004 34305.91 0 55208 122424 122424 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.56
  • if_expr:buff.doom_winds.up
    single
    [T]:17.59
Lava Lash 1319 2.8% 18.5 15.78sec 21359 18206 Direct 18.5 18165 36470 21359 17.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.52 18.52 0.00 0.00 0.00 1.1732 0.0000 395626.35 395626.35 0.00% 18206.46 18206.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.55% 15.29 6 25 18165.23 15147 31254 18158.43 15990 21201 277752 277752 0.00%
crit 17.45% 3.23 0 12 36469.71 30294 61011 35409.52 0 56953 117874 117874 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.28
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [U]:14.24
Lightning Bolt 2794 6.0% 16.7 16.90sec 50288 42813 Direct 16.7 41290 82908 50289 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.67 16.67 0.00 0.00 0.00 1.1746 0.0000 838230.41 838230.41 0.00% 42812.73 42812.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 13.06 3 25 41289.86 27612 88626 41302.80 31382 53914 539435 539435 0.00%
crit 21.62% 3.60 0 13 82908.01 55224 168714 81038.35 0 145879 298796 298796 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:4.33
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:12.34
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1457 3.1% 162.9 2.14sec 2681 1579 Direct 162.9 2652 5332 2681 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.90 162.90 0.00 0.00 0.00 1.6986 0.0000 436778.48 623985.16 30.00% 1578.53 1578.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.25% 107.92 59 163 2651.88 2257 4339 2651.82 2380 2936 286194 408859 30.00%
crit 17.34% 28.24 6 53 5332.33 4513 8588 5332.04 4676 6228 150585 215127 30.00%
miss 16.41% 26.74 7 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 747 1.6% 166.6 2.08sec 1345 792 Direct 166.6 1329 2670 1345 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.56 166.56 0.00 0.00 0.00 1.6987 0.0000 224041.80 320067.87 30.00% 791.85 791.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.29% 110.42 60 171 1328.89 1128 2169 1328.81 1202 1470 146735 209627 30.00%
crit 17.38% 28.95 10 57 2670.17 2257 4339 2670.15 2338 3126 77307 110441 30.00%
miss 16.32% 27.19 9 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7606) 0.0% (16.2%) 92.2 3.24sec 24730 21276

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.19 0.00 0.00 0.00 0.00 1.1623 0.0000 0.00 0.00 0.00% 21275.97 21275.97

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.97
  • if_expr:buff.doom_winds.up
    single
    [Q]:79.22
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4097 (5070) 8.7% (10.8%) 122.9 3.24sec 12363 0 Direct 122.9 (184.2) 8506 17077 9991 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.92 122.92 0.00 0.00 0.00 0.0000 0.0000 1228014.98 1754351.85 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 101.63 51 163 8505.77 2623 23335 8522.24 7164 10196 864390 1234874 30.00%
crit 17.32% 21.29 6 46 17077.31 5246 44160 17112.97 11614 24528 363625 519478 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 973 2.1% 61.3 5.48sec 4758 0 Direct 61.3 4758 0 4758 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.29 61.29 0.00 0.00 0.00 0.0000 0.0000 291630.71 291630.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.29 24 110 4758.29 1152 19390 4772.62 3696 6364 291631 291631 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2049 (2536) 4.4% (5.4%) 122.9 3.24sec 6184 0 Direct 122.9 (184.2) 4252 8551 4998 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.92 122.92 0.00 0.00 0.00 0.0000 0.0000 614367.10 877689.66 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 101.57 52 162 4251.58 1312 11667 4260.13 3576 5042 431838 616927 30.00%
crit 17.37% 21.35 7 45 8551.10 2623 22522 8562.89 5771 11836 182529 260763 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 486 1.0% 61.3 5.48sec 2378 0 Direct 61.3 2378 0 2378 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.29 61.29 0.00 0.00 0.00 0.0000 0.0000 145770.82 145770.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.29 24 110 2378.40 576 10078 2384.96 1852 3195 145771 145771 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1007 2.1% 6.4 49.33sec 47368 40850 Direct 6.4 40444 80915 47368 17.1% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.37 6.37 0.00 0.00 0.00 1.1596 0.0000 301760.84 301760.84 0.00% 40850.26 40850.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.89% 5.28 1 9 40444.08 25569 83550 40507.73 26528 54918 213577 213577 0.00%
crit 17.11% 1.09 0 6 80915.42 51138 145022 55778.63 0 140466 88184 88184 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.63
  • if_expr:buff.doom_winds.up
    single
    [W]:4.74
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6918) 0.0% (14.7%) 1.0 0.00sec 2070373 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6918 14.7% 417.2 2.40sec 4962 0 Direct 417.2 4228 8483 4962 17.3% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 417.24 417.24 0.00 0.00 0.00 0.0000 0.0000 2070372.79 2957750.82 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 345.23 199 497 4227.69 1423 11909 4225.44 3545 4985 1459543 2085114 30.00%
crit 17.26% 72.00 32 116 8483.36 2845 23819 8478.06 6787 10383 610830 872637 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 519 1.1% 33.7 8.51sec 4609 3279 Direct 33.7 3804 7638 4609 21.0% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.74 33.74 0.00 0.00 0.00 1.4055 0.0000 155496.95 155496.95 0.00% 3279.21 3279.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.02% 26.66 0 74 3804.48 3224 6198 3798.83 0 5266 101427 101427 0.00%
crit 20.98% 7.08 0 24 7638.39 6448 12257 7558.86 0 11491 54070 54070 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 301 0.6% 39.1 7.37sec 2309 1590 Direct 39.1 1901 3825 2309 21.2% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.06 39.06 0.00 0.00 0.00 1.4526 0.0000 90190.57 90190.57 0.00% 1589.68 1589.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.79% 30.77 0 84 1901.08 1612 3099 1898.16 0 2571 58503 58503 0.00%
crit 21.21% 8.29 0 29 3824.56 3224 6198 3800.35 0 5280 31688 31688 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6924) 0.0% (14.7%) 27.5 8.71sec 75412 65525

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.48 0.00 0.00 0.00 0.00 1.1509 0.0000 0.00 0.00 0.00% 65524.97 65524.97

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:27.48
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.00
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1870 (2207) 4.0% (4.7%) 36.6 8.71sec 18045 0 Direct 36.6 (49.0) 13035 26188 15298 17.2% (12.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.60 36.58 0.00 0.00 0.00 0.0000 0.0000 559555.56 559555.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.79% 30.28 0 99 13035.01 3748 32891 12976.71 0 21287 394730 394730 0.00%
crit 17.21% 6.29 0 24 26188.19 7495 66621 25683.70 0 54553 164826 164826 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 337 0.7% 12.4 18.46sec 8125 0 Direct 12.4 8125 0 8125 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.41 12.41 0.00 0.00 0.00 0.0000 0.0000 100815.65 100815.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.41 0 39 8124.93 3158 30407 8017.11 0 16410 100816 100816 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 934 (1103) 2.0% (2.3%) 36.6 8.71sec 9018 0 Direct 36.6 (49.0) 6518 13086 7644 17.1% (12.8%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.60 36.58 0.00 0.00 0.00 0.0000 0.0000 279590.20 279590.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 30.31 0 104 6518.37 1874 16446 6489.10 0 11073 197550 197550 0.00%
crit 17.14% 6.27 0 30 13085.50 3748 32553 12828.61 0 28236 82040 82040 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 169 0.4% 12.4 18.46sec 4064 0 Direct 12.4 4064 0 4064 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.41 12.41 0.00 0.00 0.00 0.0000 0.0000 50424.22 50424.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.41 0 39 4063.79 1579 14293 4017.29 0 9275 50424 50424 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3615 7.7% 27.5 8.71sec 39381 0 Direct 27.5 32497 65207 39382 21.0% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.48 27.48 0.00 0.00 0.00 0.0000 0.0000 1082169.07 1082169.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.95% 21.70 0 67 32497.45 15340 56321 32414.65 0 46723 705073 705073 0.00%
crit 21.05% 5.78 0 21 65206.83 30680 112288 64045.28 0 99336 377096 377096 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 421 / 88
melee 421 0.2% 40.9 2.40sec 643 428 Direct 40.9 548 1096 643 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.94 40.94 0.00 0.00 0.00 1.5013 0.0000 26334.55 37621.75 30.00% 428.45 428.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 33.85 21 62 548.33 475 892 547.18 475 685 18558 26513 30.00%
crit 17.33% 7.10 0 22 1095.85 950 1783 1093.64 0 1462 7776 11109 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 3923 / 2755
melee 3923 5.9% 371.0 1.61sec 2224 1946 Direct 371.0 1897 3788 2224 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 371.03 371.03 0.00 0.00 0.00 1.1427 0.0000 825153.52 1178820.79 30.00% 1946.22 1946.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 306.84 177 456 1896.67 1588 3106 1897.13 1747 2126 581966 831401 30.00%
crit 17.30% 64.20 29 113 3788.20 3176 6212 3790.04 3418 4408 243188 347420 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 308.81sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0044 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.15
Feral Spirit 14.9 21.13sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.93 0.00 0.00 0.00 0.00 1.1541 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.93
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 307.42sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.48
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.5 0.0 41.3sec 41.3sec 7.7sec 16.56% 91.91% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 314.8s
  • trigger_min/max:6.0s / 314.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.0s

Stack Uptimes

  • ascendance_1:16.56%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.40% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 14.9 0.0 24.3sec 20.7sec 17.9sec 70.19% 100.00% 0.0 (0.0) 11.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.7s / 131.5s
  • trigger_min/max:6.7s / 44.7s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 112.9s

Stack Uptimes

  • earthen_weapon_2:67.43%
  • earthen_weapon_4:2.76%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.4 1.0 37.6sec 32.7sec 10.8sec 26.52% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 286.0s
  • trigger_min/max:1.7s / 286.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.6s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.52%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.5 1.0 37.2sec 32.5sec 10.7sec 26.65% 0.00% 1.0 (1.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 271.5s
  • trigger_min/max:1.7s / 268.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.6s

Stack Uptimes

  • elemental_blast_haste_1:26.65%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.4 1.0 37.7sec 32.8sec 10.8sec 26.38% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 332.2s
  • trigger_min/max:1.7s / 332.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_mastery_1:26.38%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.4sec 99.4sec 58.0sec 24.67% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.67%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.8sec 99.7sec 57.8sec 24.88% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.8s

Stack Uptimes

  • elemental_chaos_earth_1:24.88%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 122.8sec 97.7sec 58.2sec 25.24% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.24%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.8sec 99.0sec 58.1sec 25.20% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.20%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.4sec 307.4sec 27.4sec 13.28% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.2s
  • trigger_min/max:300.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.28%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 11.8 3.1 26.5sec 21.1sec 17.8sec 70.20% 0.00% 60.3 (60.3) 11.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 131.5s
  • trigger_min/max:7.4s / 44.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 112.9s

Stack Uptimes

  • feral_spirit_1:70.20%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.5 388.6 6.9sec 0.7sec 5.9sec 85.23% 90.89% 388.6 (923.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 69.4s
  • trigger_min/max:0.0s / 17.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.2s

Stack Uptimes

  • flurry_1:19.85%
  • flurry_2:34.78%
  • flurry_3:30.60%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 121.7 17.7sec 2.1sec 14.6sec 84.86% 100.00% 58.3 (58.3) 16.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 51.2s
  • trigger_min/max:0.0s / 41.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.45%
  • forceful_winds_2:13.73%
  • forceful_winds_3:12.40%
  • forceful_winds_4:10.62%
  • forceful_winds_5:33.67%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.7sec 46.7sec 13.0sec 19.46% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 212.7s
  • trigger_min/max:0.2s / 204.8s
  • trigger_pct:98.78%
  • duration_min/max:0.0s / 47.0s

Stack Uptimes

  • forgestorm_ignited_1:19.46%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.0 1.2 15.9sec 15.0sec 7.7sec 48.90% 79.33% 1.2 (1.2) 5.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 85.1s
  • trigger_min/max:8.3s / 85.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.1s

Stack Uptimes

  • ice_strike_1:48.90%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.1 21.0 12.8sec 6.7sec 8.0sec 62.08% 0.00% 21.0 (21.0) 22.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 86.5s
  • trigger_min/max:0.8s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.9s

Stack Uptimes

  • legacy_of_the_frost_witch_1:62.08%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 49.3 426.6 6.1sec 1.2sec 5.3sec 86.91% 100.00% 70.1 (75.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 52.8s
  • trigger_min/max:0.0s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.1s

Stack Uptimes

  • maelstrom_weapon_1:8.72%
  • maelstrom_weapon_2:10.23%
  • maelstrom_weapon_3:11.91%
  • maelstrom_weapon_4:12.48%
  • maelstrom_weapon_5:8.40%
  • maelstrom_weapon_6:7.21%
  • maelstrom_weapon_7:5.64%
  • maelstrom_weapon_8:4.91%
  • maelstrom_weapon_9:4.01%
  • maelstrom_weapon_10:13.40%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.2sec 45.6sec 16.5sec 23.74% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 221.6s
  • trigger_min/max:0.0s / 209.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.4s

Stack Uptimes

  • sophic_devotion_1:23.74%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.2sec 45.5sec 32.2sec 38.29% 0.00% 25.7 (25.7) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 272.2s
  • trigger_min/max:0.0s / 207.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 181.7s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.22%
  • spiraling_winds_10:17.78%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.5 0.0 41.3sec 41.3sec 7.7sec 16.56% 100.00% 43.2 (43.2) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 314.8s
  • trigger_min/max:6.0s / 314.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.0s

Stack Uptimes

  • static_accumulation_1:16.56%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 63.0 19.3 4.7sec 3.6sec 1.1sec 23.80% 52.35% 19.3 (19.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 68.0s
  • trigger_min/max:0.0s / 68.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • stormbringer_1:23.80%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 33.0 66.0 17.8s 15.0s 60.3s
Windfury-ForcefulWinds: 2 51.5 36.0 69.0 18.0s 0.5s 72.8s
Windfury-ForcefulWinds: 3 49.9 30.0 69.0 18.5s 1.1s 78.8s
Windfury-ForcefulWinds: 4 46.8 24.0 69.0 19.8s 0.9s 94.7s
Windfury-ForcefulWinds: 5 217.3 90.0 363.0 4.6s 0.0s 90.1s
windfury_totem_extra_attack_mh 28.1 6.0 52.0 10.4s 1.2s 133.0s
windfury_totem_extra_attack_oh 29.4 9.0 55.0 10.0s 0.1s 108.5s
Windfury: Unruly Winds 139.1 83.0 200.0 2.4s 0.0s 41.7s
Maelstrom Weapon: Feral Spirit 80.0 52.0 112.0 3.8s 0.0s 29.7s
Maelstrom Weapon: Elemental Assault 119.7 79.0 167.0 2.5s 0.8s 9.6s
Maelstrom Weapon: Static Accumulation 99.1 0.0 288.0 4.7s 1.0s 301.2s
Stormflurry 39.8 13.0 85.0 9.8s 0.8s 120.9s
Maelstrom Weapon: Windfury Attack 83.5 38.0 136.0 4.6s 0.0s 69.6s
Maelstrom Weapon: main_hand 27.3 7.0 54.0 11.1s 1.2s 148.8s
Maelstrom Weapon: Windlash 6.7 0.0 25.0 32.6s 1.2s 321.7s
Maelstrom Weapon: offhand 27.9 9.0 54.0 10.8s 1.2s 149.8s
Maelstrom Weapon: Windlash Off-Hand 7.8 0.0 26.0 29.0s 0.3s 322.0s
Maelstrom Weapon: Doom Winds 0.7 0.0 4.0 136.3s 90.0s 273.1s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 105.8s 40.0s 343.2s
Maelstrom Weapon: Windstrike 7.3 0.0 29.0 30.8s 0.8s 322.2s
Maelstrom Weapon: Windstrike Off-Hand 7.3 0.0 24.0 30.9s 0.8s 325.0s
Maelstrom Weapon: Lava Lash 3.7 0.0 11.0 58.6s 8.5s 329.8s
Maelstrom Weapon: Ice Strike 4.0 0.0 14.0 57.8s 8.3s 330.8s
Maelstrom Weapon: Stormstrike 24.6 7.0 46.0 12.6s 0.8s 214.0s
Maelstrom Weapon: Stormstrike Off-Hand 24.6 7.0 52.0 12.6s 0.8s 138.9s
Flametongue: Windfury Attack 417.2 249.0 600.0 2.4s 0.0s 41.7s
Stormbringer: Windfury Attack 43.9 17.0 81.0 7.7s 0.0s 96.1s
Flametongue: main_hand 136.2 68.0 205.0 2.6s 1.2s 72.6s
Windfury: main_hand 51.9 23.0 83.0 6.3s 1.2s 106.1s
Flametongue: Windlash 33.7 0.0 96.0 8.5s 1.2s 300.9s
Windfury: Windlash 12.6 0.0 40.0 19.7s 1.2s 309.0s
Flametongue: offhand 139.4 79.0 199.0 2.6s 1.2s 69.3s
Flametongue: Windlash Off-Hand 39.1 0.0 105.0 7.3s 0.1s 300.5s
Flametongue: Sundering 6.4 3.0 9.0 49.4s 40.0s 178.4s
Stormbringer: Sundering 0.7 0.0 5.0 113.2s 40.0s 337.3s
Windfury: Sundering 3.1 0.0 8.0 88.8s 40.0s 342.8s
Flametongue: Windstrike 36.6 0.0 118.0 8.6s 0.8s 301.8s
Stormbringer: Windstrike 3.8 0.0 19.0 45.7s 0.8s 326.5s
Windfury: Windstrike 13.9 0.0 55.0 18.9s 0.8s 307.2s
Flametongue: Windstrike Off-Hand 36.6 0.0 118.0 8.6s 0.8s 301.8s
Stormbringer: Windstrike Off-Hand 3.8 0.0 17.0 45.2s 0.8s 354.3s
Flametongue: Lava Lash 18.5 12.0 26.0 15.8s 8.4s 84.2s
Stormbringer: Lava Lash 1.9 0.0 9.0 76.7s 8.7s 331.0s
Flametongue: Ice Strike 20.2 12.0 28.0 15.0s 8.3s 85.1s
Stormbringer: Ice Strike 2.1 0.0 9.0 77.3s 8.3s 326.9s
Windfury: Ice Strike 7.9 1.0 17.0 37.6s 8.3s 250.8s
Flametongue: Stormstrike 122.9 64.0 186.0 3.2s 0.8s 70.4s
Stormbringer: Stormstrike 13.0 1.0 31.0 22.0s 0.8s 275.4s
Windfury: Stormstrike 49.6 21.0 90.0 7.0s 0.8s 103.5s
Flametongue: Stormstrike Off-Hand 122.9 64.0 186.0 3.2s 0.8s 70.4s
Stormbringer: Stormstrike Off-Hand 13.0 2.0 31.0 21.9s 0.8s 264.9s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.40% 13.06% 45.79% 0.8s 0.0s 37.2s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7900.0011.46410.3943.87218.487
Doom Winds0.5260.0012.3991.1190.0004.472
Sundering9.8480.001138.39150.4571.219160.995
Windstrike1.0590.0013.95128.8470.00091.322
Lava Lash4.1430.00171.87070.71621.313146.632
Flame Shock21.4640.001252.610219.53527.288322.638
Ice Strike3.5170.00173.03064.83912.660155.220
Frost Shock12.7140.001195.566190.53349.502291.175
Elemental Blast3.7340.00136.5332.9490.00045.453
Stormstrike1.0550.0014.97092.66148.789146.962
Earth Elemental9.7580.00447.0301.4250.00047.030

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana668.39252281.37100.00%377.44227120.6047.38%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 840.93 843.57 227122.1 49209.7 43000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.1434561.061375.001375.0160.41
Flame ShockMana 11.328492.07750.00284.5453.13
Frost ShockMana 16.488238.30500.00500.0236.86
Ice StrikeMana 20.1633256.711650.001650.0112.46
Lava LashMana 18.527409.09400.00400.0153.40
Lightning BoltMana 16.678334.56500.00500.01100.57
StormstrikeMana 122.92122917.881000.001333.3418.55
SunderingMana 6.3719111.853000.003000.0215.79

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 47012.46
Minimum 36538.98
Maximum 65483.88
Spread ( max - min ) 28944.90
Range [ ( max - min ) / 2 * 100% ] 30.78%
Standard Deviation 3841.6628
5th Percentile 41100.83
95th Percentile 53619.57
( 95th Percentile - 5th Percentile ) 12518.74
Mean Distribution
Standard Deviation 44.3627
95.00% Confidence Interval ( 46925.51 - 47099.41 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 257
0.1% Error 25652
0.1 Scale Factor Error with Delta=300 125986
0.05 Scale Factor Error with Delta=300 503944
0.01 Scale Factor Error with Delta=300 12598597
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 47012.46
Minimum 36538.98
Maximum 65483.88
Spread ( max - min ) 28944.90
Range [ ( max - min ) / 2 * 100% ] 30.78%
Standard Deviation 3841.6628
5th Percentile 41100.83
95th Percentile 53619.57
( 95th Percentile - 5th Percentile ) 12518.74
Mean Distribution
Standard Deviation 44.3627
95.00% Confidence Interval ( 46925.51 - 47099.41 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 257
0.1% Error 25652
0.1 Scale Factor Error with Delta=300 125986
0.05 Scale Factor Error with Delta=300 503944
0.01 Scale Factor Error with Delta=300 12598597
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 47012.46
Minimum 36538.98
Maximum 65483.88
Spread ( max - min ) 28944.90
Range [ ( max - min ) / 2 * 100% ] 30.78%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13235622.63
Minimum 8786071.42
Maximum 19038862.10
Spread ( max - min ) 10252790.68
Range [ ( max - min ) / 2 * 100% ] 38.73%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.48 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.93 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 27.48 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.97 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
L 2.56 ice_strike,if=buff.doom_winds.up
M 1.63 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.31 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
O 4.28 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
P 0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 79.22 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.14 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 4.33 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.59 ice_strike
U 14.24 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
V 12.34 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.74 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 16.48 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.15 earth_elemental
Z 10.01 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGBKLKJMJJJJFJJJJNJQQQRQQRTFUQVQQXVQQRQTUXYQJJFJRQQTQSQUWXRQQSQTXFUQRXZQQTSQQQQQRQQTOXGKFKJJJJRQQRQOFTVQWQRQVQUTQQQJRJFQSQTUXZQRQXZVTQURQWXZQTVUXFQZRQXQTQRQUDEVGXKKKKLFQRQUWVQRTXVQJJJUFJRJJJJTFJJJJRJOVQTXZWQFJJJQRQQRQTUVXQFVQXZRQTUVXQQRGKKLKKKSFOQQQRQTQVWQJJR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_earth
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, crumbling_power(20), elemental_chaos_earth
0:00.870 default G doom_winds Fluffy_Pillow 40642.0/50000: 81% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_earth
0:01.736 default B potion Fluffy_Pillow 42027.6/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, crumbling_power(19), spiraling_winds, elemental_chaos_earth
0:01.736 single K stormstrike Fluffy_Pillow 42027.6/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, crumbling_power(19), spiraling_winds, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.606 single L ice_strike Fluffy_Pillow 42419.6/50000: 85% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), doom_winds, crumbling_power(18), spiraling_winds, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.471 single K stormstrike Fluffy_Pillow 42153.6/50000: 84% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, ice_strike, crumbling_power(17), spiraling_winds, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.339 single J windstrike Fluffy_Pillow 42542.4/50000: 85% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(16), spiraling_winds(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.207 single M sundering Fluffy_Pillow 43931.2/50000: 88% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, crumbling_power(15), spiraling_winds(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.075 single J windstrike Fluffy_Pillow 42320.0/50000: 85% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(14), spiraling_winds(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.943 single J windstrike Fluffy_Pillow 43708.8/50000: 87% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.810 single J windstrike Fluffy_Pillow 45096.0/50000: 90% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.677 single J windstrike Fluffy_Pillow 46483.2/50000: 93% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.544 default F feral_spirit Fluffy_Pillow 47870.4/50000: 96% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.412 single J windstrike Fluffy_Pillow 49259.2/50000: 99% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.279 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.147 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.101 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.055 single N flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.008 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.963 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.916 single Q stormstrike Fluffy_Pillow 48524.8/50000: 97% mana bloodlust, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.869 single Q stormstrike Fluffy_Pillow 48049.6/50000: 96% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power, spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.822 single R elemental_blast Fluffy_Pillow 48574.4/50000: 97% mana bloodlust, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.776 single Q stormstrike Fluffy_Pillow 48725.8/50000: 97% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.732 single Q stormstrike Fluffy_Pillow 49255.4/50000: 99% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.686 single R elemental_blast Fluffy_Pillow 49781.8/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.639 single T ice_strike Fluffy_Pillow 49931.6/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.592 default F feral_spirit Fluffy_Pillow 49806.4/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.546 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(4), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.502 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.457 single V lightning_bolt Fluffy_Pillow 48528.0/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.410 single Q stormstrike Fluffy_Pillow 49552.8/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.364 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.319 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.271 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.224 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:32.177 single Q stormstrike Fluffy_Pillow 48524.8/50000: 97% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), elemental_chaos_earth
0:33.132 single R elemental_blast Fluffy_Pillow 49052.8/50000: 98% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_earth
0:34.089 single Q stormstrike Fluffy_Pillow 49209.0/50000: 98% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:35.013 single T ice_strike Fluffy_Pillow 48687.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:35.940 single U lava_lash Fluffy_Pillow 48520.6/50000: 97% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:36.865 single X frost_shock Fluffy_Pillow 49600.6/50000: 99% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:37.790 single Y earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:38.715 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
0:39.641 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(7), static_accumulation, forgestorm_ignited, elemental_chaos_earth
0:40.567 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(6), static_accumulation, forgestorm_ignited, elemental_chaos_earth
0:41.770 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:42.971 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_chaos_earth
0:44.173 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
0:45.412 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
0:46.615 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
0:47.818 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
0:49.022 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
0:50.224 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(5), elemental_chaos_earth
0:51.426 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
0:52.627 single U lava_lash Fluffy_Pillow 49921.6/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
0:53.828 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
0:55.030 single X frost_shock Fluffy_Pillow 48923.2/50000: 98% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
0:56.270 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(8), elemental_chaos_earth
0:57.508 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth
0:58.709 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
0:59.911 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
1:01.114 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
1:02.317 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
1:03.518 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
1:04.721 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
1:05.924 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
1:07.126 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_fire
1:08.364 single R elemental_blast Fluffy_Pillow 48980.8/50000: 98% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_fire
1:09.604 single X frost_shock Fluffy_Pillow 49589.8/50000: 99% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), forgestorm_ignited, elemental_chaos_fire
1:10.842 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, forgestorm_ignited, elemental_chaos_fire
1:12.081 Waiting     0.970 sec 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
1:13.051 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
1:14.537 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), elemental_chaos_fire
1:15.774 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_fire
1:17.012 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:18.252 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:19.490 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:20.729 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(3), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:21.969 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:23.207 single Q stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry, forceful_winds(4), stormbringer, maelstrom_weapon(8), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:24.445 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:25.682 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:26.884 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:28.086 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
1:29.287 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:30.489 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(3), ice_strike, elemental_chaos_fire
1:31.692 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(3), elemental_chaos_fire
1:32.894 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(4), doom_winds, elemental_chaos_fire
1:34.096 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(7), doom_winds, elemental_chaos_fire
1:35.297 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, elemental_chaos_fire
1:36.535 single J windstrike Fluffy_Pillow 48980.8/50000: 98% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, elemental_chaos_fire
1:37.773 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, elemental_chaos_fire
1:39.011 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, elemental_chaos_fire
1:40.248 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
1:41.485 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_fire
1:42.722 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
1:43.925 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
1:45.126 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
1:46.328 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
1:47.531 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
1:48.732 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
1:49.935 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_fire
1:51.138 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_fire
1:52.340 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:53.578 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:54.818 single Q stormstrike Fluffy_Pillow 48984.0/50000: 98% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:56.056 single R elemental_blast Fluffy_Pillow 49964.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:57.297 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_fire
1:58.535 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_fire
1:59.772 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:01.010 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:02.249 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:03.486 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:04.724 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_frost
2:05.963 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_frost
2:07.201 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, forceful_winds(3), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, sophic_devotion, elemental_chaos_frost
2:08.438 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(4), maelstrom_weapon(8), static_accumulation, ice_strike, sophic_devotion, elemental_chaos_frost
2:09.677 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:10.915 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:12.154 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:13.393 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:14.631 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
2:15.870 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
2:17.111 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:18.348 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:19.586 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_frost
2:20.823 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_frost
2:22.062 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_frost
2:23.300 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
2:24.538 single X frost_shock Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
2:25.776 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
2:27.014 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost
2:28.253 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), elemental_chaos_frost
2:29.492 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon, ice_strike, elemental_chaos_frost
2:30.731 single U lava_lash Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(4), ice_strike, elemental_chaos_frost
2:31.969 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(5), ice_strike, elemental_chaos_frost
2:33.209 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:34.448 single W sundering Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:35.687 single X frost_shock Fluffy_Pillow 48964.8/50000: 98% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:36.926 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
2:38.165 Waiting     0.999 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, maelstrom_weapon(4), elemental_chaos_frost
2:39.164 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), elemental_chaos_frost
2:40.621 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(6), elemental_chaos_frost
2:41.858 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds, maelstrom_weapon(6), ice_strike, elemental_chaos_frost
2:43.096 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(2), ice_strike, elemental_chaos_frost
2:44.333 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), ice_strike, elemental_chaos_frost
2:45.571 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), elemental_chaos_frost
2:46.811 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, elemental_chaos_frost
2:48.049 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_frost
2:49.286 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_frost
2:50.524 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, legacy_of_the_frost_witch, elemental_chaos_frost
2:51.760 single X frost_shock Fluffy_Pillow 48977.6/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
2:52.998 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost
2:54.237 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_frost
2:55.475 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_frost
2:56.713 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), ice_strike, elemental_chaos_frost
2:57.951 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:59.191 single U lava_lash Fluffy_Pillow 49984.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:00.430 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:00.430 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), forgestorm_ignited, elemental_chaos_air
3:00.430 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), forgestorm_ignited, elemental_chaos_air
3:01.522 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), forgestorm_ignited, elemental_chaos_air
3:02.783 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), doom_winds, ice_strike, crumbling_power(19), forgestorm_ignited, elemental_chaos_air
3:03.876 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), doom_winds, crumbling_power(18), forgestorm_ignited, elemental_chaos_air
3:04.967 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(4), doom_winds, crumbling_power(17), forgestorm_ignited, elemental_chaos_air
3:06.057 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(7), doom_winds, crumbling_power(16), forgestorm_ignited, elemental_chaos_air
3:07.149 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(9), doom_winds, crumbling_power(15), forgestorm_ignited, elemental_chaos_air
3:08.240 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), forceful_winds(5), maelstrom_weapon(10), doom_winds, crumbling_power(14), forgestorm_ignited, elemental_chaos_air
3:09.331 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(13), elemental_chaos_air
3:10.423 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(12), elemental_chaos_air
3:11.515 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(11), elemental_chaos_air
3:12.606 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds, elemental_chaos_air
3:13.805 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(2), elemental_chaos_air
3:15.006 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(2), elemental_chaos_air
3:16.206 single V lightning_bolt Fluffy_Pillow 48920.0/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(3), elemental_chaos_air
3:17.408 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(3), elemental_chaos_air
3:18.610 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(4), elemental_chaos_air
3:20.022 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(5), elemental_chaos_air
3:21.224 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(5), elemental_chaos_air
3:22.426 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(6), elemental_chaos_air
3:23.625 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air
3:24.826 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air
3:26.025 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:27.226 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:28.426 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
3:29.626 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, forceful_winds(5), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
3:30.828 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
3:32.029 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(8), static_accumulation, spiraling_winds(10), elemental_chaos_air
3:33.227 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
3:34.392 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
3:35.557 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
3:36.722 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_air
3:37.888 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_air
3:39.054 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:40.219 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:41.386 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:42.553 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:43.755 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:44.954 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:46.154 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:47.320 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:48.485 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:49.651 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:50.816 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_air
3:51.982 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:53.147 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
3:54.311 Waiting     0.500 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, maelstrom_weapon(4), elemental_chaos_air
3:54.811 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, maelstrom_weapon(4), elemental_chaos_air
3:56.207 single Q stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry, forceful_winds(2), maelstrom_weapon(4), elemental_chaos_air
3:57.408 default F feral_spirit Fluffy_Pillow 49843.2/50000: 100% mana ascendance, forceful_winds(2), maelstrom_weapon(7), static_accumulation, elemental_chaos_air
3:58.607 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, elemental_chaos_air
3:59.809 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, elemental_chaos_air
4:01.009 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_earth
4:02.248 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_earth
4:03.487 single R elemental_blast Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_earth
4:04.726 single Q stormstrike Fluffy_Pillow 49589.8/50000: 99% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
4:05.964 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
4:07.202 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth
4:08.441 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
4:09.643 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
4:10.846 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:12.049 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:13.251 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds, maelstrom_weapon, ice_strike, elemental_chaos_earth
4:14.455 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), elemental_chaos_earth
4:15.657 default F feral_spirit Fluffy_Pillow 49923.2/50000: 100% mana elemental_blast_haste, forceful_winds(3), maelstrom_weapon(7), elemental_chaos_earth
4:16.858 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), elemental_chaos_earth
4:18.058 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
4:19.298 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
4:20.536 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
4:21.775 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth
4:23.012 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
4:24.214 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
4:25.418 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:26.622 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:27.826 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_earth
4:29.028 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, elemental_chaos_earth
4:30.230 single Q stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), elemental_chaos_earth
4:31.432 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(7), elemental_chaos_earth
4:32.635 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(4), stormbringer, legacy_of_the_frost_witch, elemental_chaos_earth
4:33.874 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:35.113 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:36.351 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:37.589 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, sophic_devotion, elemental_chaos_earth
4:38.827 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, sophic_devotion, elemental_chaos_earth
4:40.066 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, sophic_devotion, elemental_chaos_earth
4:41.304 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_earth
4:42.543 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:43.782 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:45.022 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:46.260 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:47.498 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_earth
4:48.736 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), elemental_chaos_earth
4:49.973 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
4:51.175 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
4:52.378 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:53.581 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:54.783 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_earth
4:55.984 single Q stormstrike Fluffy_Pillow 48921.6/50000: 98% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_earth
4:57.186 single J windstrike Fluffy_Pillow 49844.8/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, forgestorm_ignited, elemental_chaos_earth
4:58.389 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:59.591 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, forceful_winds(3), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [33]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 44701 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44701.4 44701.4 49.7 / 0.111% 8678.0 / 19.4% 49.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
848.3 845.4 Mana 1.93% 52.0 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 44701
Ascendance 0 (325) 0.0% (0.7%) 2.0 180.42sec 48137 44469

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0829 0.0000 0.00 0.00 0.00% 44468.55 44468.55

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 325 0.7% 2.0 180.42sec 48137 0 Direct 2.0 40323 81045 48138 19.2% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 96274.42 96274.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 1.62 0 2 40322.66 35125 52197 38738.43 0 52197 65169 65169 0.00%
crit 19.19% 0.38 0 2 81045.43 70251 104393 27901.80 0 104393 31105 31105 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 77 0.2% 3.7 90.47sec 6154 5626 Direct 3.7 6154 0 6154 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0941 0.0000 22907.07 32725.21 30.00% 5625.51 5625.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6154.11 3670 9854 6171.69 4974 7978 22907 32725 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6455 14.5% 24.7 11.69sec 78295 66038 Direct 24.7 64724 129805 78327 20.9% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.74 24.73 0.00 0.00 0.00 1.1856 0.0000 1937301.30 1937301.30 0.00% 66038.36 66038.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.10% 19.56 8 29 64724.33 43658 134950 64703.12 54949 80352 1266262 1266262 0.00%
crit 20.90% 5.17 0 16 129805.04 87317 253995 129223.78 0 217007 671040 671040 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:24.74
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1501 3.4% 32.9 8.85sec 13694 27721 Direct 32.9 2686 5394 3157 17.4% 0.0%
Periodic 183.1 1611 3234 1893 17.4% 0.0% 95.5%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.89 32.89 183.09 183.09 31.74 0.4940 1.5646 450417.54 450417.54 0.00% 1487.94 27721.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 27.17 13 45 2686.32 2272 4687 2685.41 2406 3052 72988 72988 0.00%
crit 17.40% 5.72 0 16 5393.64 4543 9034 5374.46 0 7422 30864 30864 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.63% 151.28 106 197 1610.89 2 2762 1610.35 1473 1834 243700 243700 0.00%
crit 17.37% 31.81 12 56 3233.58 3 5513 3233.28 2863 3719 102865 102865 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.15
  • if_expr:!ticking
    single
    [b]:12.67
Flametongue Weapon 0 (1450) 0.0% (3.2%) 1.0 0.00sec 434295 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1450 3.2% 1083.6 0.69sec 401 0 Direct 1083.6 342 685 401 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1083.61 1083.61 0.00 0.00 0.00 0.0000 0.0000 434295.18 434295.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 896.59 623 1172 341.59 277 570 341.65 315 387 306269 306269 0.00%
crit 17.26% 187.01 112 268 684.58 555 1140 684.75 624 771 128026 128026 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1099 2.5% 28.6 7.70sec 11526 0 Direct 28.6 9808 19716 11526 17.3% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.64 28.64 0.00 0.00 0.00 0.0000 0.0000 330047.64 330047.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 23.67 2 71 9807.51 9732 10030 9806.78 9732 10030 232133 232133 0.00%
crit 17.34% 4.97 0 21 19715.52 19463 20059 19322.99 0 20059 97915 97915 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1186 2.7% 20.0 13.86sec 17842 15014 Direct 20.0 15178 30483 17842 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.97 19.97 0.00 0.00 0.00 1.1884 0.0000 356394.70 356394.70 0.00% 15013.68 15013.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 16.50 5 33 15178.31 7339 30286 15216.55 11676 18993 250420 250420 0.00%
crit 17.40% 3.48 0 12 30483.37 14678 57425 29754.57 0 50969 105975 105975 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:19.98
Ice Strike 1431 3.2% 21.2 14.15sec 20270 17350 Direct 21.2 17253 34552 20270 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.18 21.18 0.00 0.00 0.00 1.1683 0.0000 429373.66 429373.66 0.00% 17349.83 17349.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 17.49 7 26 17252.74 14383 29677 17245.36 15235 19938 301709 301709 0.00%
crit 17.44% 3.69 0 13 34552.35 28765 58489 33879.77 0 57160 127664 127664 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.37
  • if_expr:buff.doom_winds.up
    single
    [V]:18.81
Lava Lash 1338 3.0% 19.1 14.97sec 21073 17772 Direct 19.1 17893 35990 21072 17.6% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.07 19.07 0.00 0.00 0.00 1.1857 0.0000 401949.32 401949.32 0.00% 17772.00 17772.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.43% 15.72 7 25 17893.03 15147 31254 17882.05 15382 20490 281326 281326 0.00%
crit 17.57% 3.35 0 10 35989.52 30294 61598 34963.65 0 58650 120624 120624 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.56
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [W]:16.52
Lightning Bolt 2935 6.6% 18.1 15.36sec 48664 41218 Direct 18.1 40023 80376 48665 21.4% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.12 18.12 0.00 0.00 0.00 1.1807 0.0000 881898.43 881898.43 0.00% 41217.91 41217.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.59% 14.24 4 27 40023.44 27612 87335 40010.65 30183 49323 569999 569999 0.00%
crit 21.41% 3.88 0 13 80375.55 55224 169484 79112.84 0 155113 311899 311899 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:4.05
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:14.07
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1495 3.4% 172.1 1.93sec 2611 1467 Direct 172.1 2581 5192 2611 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.08 172.08 0.00 0.00 0.00 1.7804 0.0000 449321.29 641903.92 30.00% 1466.58 1466.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.27% 114.04 72 163 2581.14 2257 4339 2579.70 2359 2932 294355 420518 30.00%
crit 17.34% 29.85 11 55 5192.16 4513 8580 5189.11 4638 6033 154967 221386 30.00%
miss 16.38% 28.19 10 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 758 1.7% 173.8 2.01sec 1310 736 Direct 173.8 1295 2603 1310 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.78 173.78 0.00 0.00 0.00 1.7797 0.0000 227600.37 325151.68 30.00% 735.88 735.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.27% 115.17 72 168 1294.56 1128 2169 1293.94 1188 1488 149091 212993 30.00%
crit 17.36% 30.16 10 57 2602.74 2257 4339 2601.52 2280 2991 78509 112159 30.00%
miss 16.37% 28.45 11 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (6872) 0.0% (15.4%) 88.6 3.21sec 23298 19661

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 88.62 0.00 0.00 0.00 0.00 1.1850 0.0000 0.00 0.00 0.00% 19660.91 19660.91

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.68
  • if_expr:buff.doom_winds.up
    single
    [R]:70.28
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:12.66
    Stormstrike (_mh) 3719 (4582) 8.4% (10.3%) 118.1 3.21sec 11656 0 Direct 118.1 (176.1) 8042 16214 9461 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.11 118.11 0.00 0.00 0.00 0.0000 0.0000 1117409.28 1596339.68 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 97.60 50 155 8042.45 2623 20076 8052.36 6703 9797 784966 1121408 30.00%
crit 17.36% 20.50 5 43 16214.46 5246 40096 16234.77 10253 23069 332444 474931 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 863 1.9% 58.0 5.45sec 4472 0 Direct 58.0 4473 0 4473 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.97 57.97 0.00 0.00 0.00 0.0000 0.0000 259277.17 259277.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.97 24 124 4472.50 1152 18301 4481.81 3414 6081 259277 259277 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1859 (2290) 4.2% (5.1%) 118.1 3.21sec 5826 0 Direct 118.1 (176.1) 4023 8087 4729 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.11 118.11 0.00 0.00 0.00 0.0000 0.0000 558564.32 797969.37 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 97.59 49 151 4023.32 1312 10038 4028.49 3475 4980 392619 560898 30.00%
crit 17.37% 20.52 5 44 8087.01 2623 20134 8097.73 4899 12070 165946 237071 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 431 1.0% 58.0 5.45sec 2235 0 Direct 58.0 2235 0 2235 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.97 57.97 0.00 0.00 0.00 0.0000 0.0000 129557.18 129557.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.97 24 124 2234.84 576 9285 2239.04 1621 3039 129557 129557 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 989 2.2% 6.5 46.76sec 45357 38789 Direct 6.5 38573 77416 45355 17.5% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.54 6.54 0.00 0.00 0.00 1.1694 0.0000 296578.47 296578.47 0.00% 38788.71 38788.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.54% 5.40 1 9 38573.37 25569 85943 38608.95 26848 72252 208178 208178 0.00%
crit 17.46% 1.14 0 5 77416.13 51138 164248 55483.17 0 143017 88401 88401 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:0.77
  • if_expr:buff.doom_winds.up
    single
    [Y]:5.77
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6854) 0.0% (15.3%) 1.0 0.00sec 2049148 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6854 15.3% 408.1 2.46sec 5021 0 Direct 408.1 4286 8559 5021 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 408.12 408.12 0.00 0.00 0.00 0.0000 0.0000 2049148.30 2927429.36 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.79% 337.88 205 474 4285.57 1423 11225 4288.93 3749 5218 1448000 2068624 30.00%
crit 17.21% 70.24 31 114 8558.51 2845 22449 8564.86 6650 11208 601148 858805 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 448 1.0% 24.0 10.21sec 5533 4074 Direct 24.0 4572 9201 5533 20.8% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.96 23.96 0.00 0.00 0.00 1.3580 0.0000 132590.17 132590.17 0.00% 4074.43 4074.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.24% 18.99 9 28 4571.75 3559 6128 4572.23 4129 5534 86816 86816 0.00%
crit 20.76% 4.97 0 14 9201.33 7118 12257 9167.85 0 11843 45774 45774 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 236 0.5% 25.2 9.69sec 2773 2030 Direct 25.2 2291 4605 2773 20.8% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.23 25.23 0.00 0.00 0.00 1.3666 0.0000 69982.47 69982.47 0.00% 2029.54 2029.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.16% 19.97 11 30 2291.20 1780 3064 2291.26 2074 2772 45763 45763 0.00%
crit 20.84% 5.26 0 13 4604.79 3626 6128 4592.04 0 6060 24219 24219 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6586) 0.0% (14.6%) 20.3 10.01sec 96200 97897

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.26 0.00 0.00 0.00 0.00 0.9827 0.0000 0.00 0.00 0.00% 97897.11 97897.11

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:20.25
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.01
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1812 (2218) 4.0% (4.9%) 27.0 10.01sec 24283 0 Direct 27.0 (38.7) 16968 33986 19833 16.8% (11.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.03 27.03 0.00 0.00 0.00 0.0000 0.0000 536113.98 536113.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.16% 22.48 11 40 16967.62 4954 31358 17080.04 12249 23189 381421 381421 0.00%
crit 16.84% 4.55 0 13 33986.45 9908 61186 33920.56 0 58616 154693 154693 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 407 0.9% 11.6 17.80sec 10327 0 Direct 11.6 10327 0 10327 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.65 11.65 0.00 0.00 0.00 0.0000 0.0000 120282.71 120282.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.65 3 21 10327.41 3290 27754 10310.30 7163 16271 120283 120283 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 905 (1108) 2.0% (2.5%) 27.0 10.01sec 12134 0 Direct 27.0 (38.7) 8479 17042 9913 16.7% (11.7%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.03 27.03 0.00 0.00 0.00 0.0000 0.0000 267951.62 267951.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.25% 22.50 11 39 8478.81 2477 15679 8534.52 6440 12231 190811 190811 0.00%
crit 16.75% 4.53 0 14 17041.86 5039 31200 16992.91 0 28945 77141 77141 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 203 0.4% 11.6 17.80sec 5156 0 Direct 11.6 5156 0 5156 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.65 11.65 0.00 0.00 0.00 0.0000 0.0000 60049.48 60049.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.65 3 21 5155.71 1644 13877 5150.31 3618 8500 60049 60049 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3260 7.2% 20.3 10.02sec 47636 0 Direct 20.3 39342 78958 47637 20.9% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.25 20.25 0.00 0.00 0.00 0.0000 0.0000 964733.60 964733.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.06% 16.01 7 23 39341.79 18282 56321 39333.22 33053 48425 629938 629938 0.00%
crit 20.94% 4.24 0 12 78958.45 37295 112643 78374.85 0 103571 334796 334796 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 401 / 83
melee 401 0.2% 39.4 2.42sec 630 408 Direct 39.4 537 1075 630 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.38 39.38 0.00 0.00 0.00 1.5460 0.0000 24820.80 35459.19 30.00% 407.66 407.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 32.55 21 53 536.99 475 791 536.48 475 687 17480 24971 30.00%
crit 17.35% 6.83 0 18 1074.70 950 1582 1072.72 0 1436 7341 10488 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4148 / 2582
melee 4148 5.8% 342.8 1.73sec 2252 2009 Direct 342.8 1922 3835 2252 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 342.76 342.76 0.00 0.00 0.00 1.1211 0.0000 771931.94 1102788.03 30.00% 2008.79 2008.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 283.61 202 369 1921.91 1588 3071 1922.26 1757 2181 545061 778678 30.00%
crit 17.26% 59.16 29 97 3835.03 3176 6141 3835.83 3429 4425 226871 324110 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.69sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 306.09sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0082 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.15
Feral Spirit 13.5 23.98sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.52 0.00 0.00 0.00 0.00 1.1406 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.52
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 95.61% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.7s
  • trigger_min/max:180.2s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.9sec 12.74% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.5s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.51% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.7s
  • trigger_min/max:90.0s / 92.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 13.5 0.0 25.9sec 22.8sec 17.5sec 62.24% 100.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.3s / 73.6s
  • trigger_min/max:6.1s / 45.8s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 54.3s

Stack Uptimes

  • earthen_weapon_2:58.09%
  • earthen_weapon_4:4.15%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.3 1.0 37.3sec 32.5sec 10.7sec 26.17% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 252.0s
  • trigger_min/max:1.7s / 252.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.17%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.3 0.9 37.0sec 32.4sec 10.7sec 26.21% 0.00% 0.9 (0.9) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 255.6s
  • trigger_min/max:1.7s / 255.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.7s

Stack Uptimes

  • elemental_blast_haste_1:26.21%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.2 1.0 37.4sec 32.6sec 10.8sec 26.00% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 252.7s
  • trigger_min/max:1.7s / 252.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.4s

Stack Uptimes

  • elemental_blast_mastery_1:26.00%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 124.3sec 99.3sec 57.8sec 24.79% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.1s

Stack Uptimes

  • elemental_chaos_air_1:24.79%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.1sec 99.5sec 58.0sec 24.90% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 326.1s

Stack Uptimes

  • elemental_chaos_earth_1:24.90%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 125.6sec 99.8sec 58.5sec 25.16% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.16%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.6sec 98.5sec 58.2sec 25.15% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.9s

Stack Uptimes

  • elemental_chaos_frost_1:25.15%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.0sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 330.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 2.9 29.6sec 24.0sec 17.5sec 62.25% 0.00% 53.3 (53.3) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 73.6s
  • trigger_min/max:6.1s / 45.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.3s

Stack Uptimes

  • feral_spirit_1:62.25%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.8 368.2 6.9sec 0.7sec 5.8sec 84.11% 90.47% 368.2 (872.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 64.0s
  • trigger_min/max:0.0s / 16.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.5s

Stack Uptimes

  • flurry_1:20.23%
  • flurry_2:33.16%
  • flurry_3:30.72%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 118.8 17.8sec 2.2sec 14.6sec 84.02% 100.00% 57.4 (57.4) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 57.5s
  • trigger_min/max:0.0s / 45.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.37%
  • forceful_winds_2:14.38%
  • forceful_winds_3:12.79%
  • forceful_winds_4:10.55%
  • forceful_winds_5:30.94%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.8 57.5sec 46.6sec 12.9sec 19.40% 0.00% 0.8 (0.8) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 204.9s
  • trigger_min/max:0.2s / 200.3s
  • trigger_pct:98.83%
  • duration_min/max:0.0s / 47.0s

Stack Uptimes

  • forgestorm_ignited_1:19.40%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.4 0.8 14.7sec 14.1sec 7.1sec 48.16% 76.96% 0.8 (0.8) 4.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 63.8s
  • trigger_min/max:8.5s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.1s

Stack Uptimes

  • ice_strike_1:48.16%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.2 16.0 12.5sec 7.4sec 7.1sec 57.13% 0.00% 16.0 (16.0) 23.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 52.1s
  • trigger_min/max:0.8s / 36.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.4s

Stack Uptimes

  • legacy_of_the_frost_witch_1:57.13%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 46.6 381.1 6.5sec 1.4sec 5.5sec 85.53% 100.00% 43.3 (47.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 37.8s
  • trigger_min/max:0.0s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.6s

Stack Uptimes

  • maelstrom_weapon_1:9.70%
  • maelstrom_weapon_2:11.37%
  • maelstrom_weapon_3:13.02%
  • maelstrom_weapon_4:13.65%
  • maelstrom_weapon_5:8.80%
  • maelstrom_weapon_6:7.10%
  • maelstrom_weapon_7:5.27%
  • maelstrom_weapon_8:4.32%
  • maelstrom_weapon_9:3.44%
  • maelstrom_weapon_10:8.85%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 60.8sec 45.8sec 16.5sec 23.59% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 194.3s
  • trigger_min/max:0.1s / 194.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.8s

Stack Uptimes

  • sophic_devotion_1:23.59%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.6sec 45.5sec 32.0sec 38.36% 0.00% 25.7 (25.7) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 240.8s
  • trigger_min/max:0.0s / 194.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 174.4s

Stack Uptimes

  • spiraling_winds_1:2.36%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.33%
  • spiraling_winds_4:2.30%
  • spiraling_winds_5:2.29%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.24%
  • spiraling_winds_9:2.22%
  • spiraling_winds_10:17.75%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.7 18.8 5.0sec 3.8sec 1.2sec 23.20% 54.48% 18.8 (18.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 69.7s
  • trigger_min/max:0.0s / 69.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.2s

Stack Uptimes

  • stormbringer_1:23.20%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.2 36.0 66.0 17.9s 15.0s 57.5s
Windfury-ForcefulWinds: 2 50.6 33.0 69.0 18.1s 0.3s 68.5s
Windfury-ForcefulWinds: 3 48.7 30.0 69.0 18.8s 0.5s 88.1s
Windfury-ForcefulWinds: 4 45.1 24.0 66.0 20.4s 1.1s 128.8s
Windfury-ForcefulWinds: 5 212.5 114.0 345.0 4.7s 0.0s 93.2s
windfury_totem_extra_attack_mh 27.7 10.0 55.0 10.6s 1.2s 144.8s
windfury_totem_extra_attack_oh 28.3 10.0 51.0 10.4s 0.1s 138.2s
Windfury: Unruly Winds 136.0 87.0 190.0 2.5s 0.0s 45.2s
Maelstrom Weapon: Feral Spirit 71.2 50.0 97.0 4.2s 0.0s 30.8s
Maelstrom Weapon: Elemental Assault 108.9 74.0 148.0 2.7s 0.8s 10.9s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.4s
Stormflurry 36.3 8.0 71.0 10.7s 0.8s 140.3s
Maelstrom Weapon: Windfury Attack 81.5 41.0 134.0 4.7s 0.0s 78.8s
Maelstrom Weapon: main_hand 28.8 10.0 58.0 10.2s 1.3s 112.0s
Maelstrom Weapon: Windlash 4.8 0.0 14.0 43.8s 1.2s 195.1s
Maelstrom Weapon: offhand 29.1 11.0 54.0 10.0s 1.3s 137.0s
Maelstrom Weapon: Windlash Off-Hand 5.1 0.0 14.0 41.8s 1.2s 194.5s
Maelstrom Weapon: Doom Winds 0.8 0.0 4.0 136.0s 90.0s 274.0s
Maelstrom Weapon: Sundering 1.3 0.0 7.0 101.5s 40.0s 344.1s
Maelstrom Weapon: Windstrike 5.4 0.0 15.0 40.6s 0.8s 193.5s
Maelstrom Weapon: Windstrike Off-Hand 5.4 0.0 15.0 39.9s 0.8s 192.7s
Maelstrom Weapon: Lava Lash 3.8 0.0 13.0 56.8s 9.0s 305.7s
Maelstrom Weapon: Ice Strike 4.2 0.0 14.0 54.7s 8.7s 328.8s
Maelstrom Weapon: Stormstrike 23.6 7.0 53.0 12.5s 0.9s 198.0s
Maelstrom Weapon: Stormstrike Off-Hand 23.7 7.0 47.0 12.5s 0.9s 157.9s
Flametongue: Windfury Attack 408.1 261.0 570.0 2.5s 0.0s 45.2s
Stormbringer: Windfury Attack 43.0 17.0 78.0 7.9s 0.0s 97.3s
Flametongue: main_hand 143.9 93.0 201.0 2.5s 1.3s 32.0s
Windfury: main_hand 48.8 21.0 82.0 6.3s 1.3s 85.0s
Flametongue: Windlash 24.0 19.0 31.0 10.2s 1.2s 170.4s
Windfury: Windlash 16.2 10.0 25.0 14.8s 1.2s 176.9s
Flametongue: offhand 145.3 95.0 199.0 2.5s 1.3s 26.0s
Flametongue: Windlash Off-Hand 25.2 20.0 33.0 9.7s 1.2s 168.2s
Flametongue: Sundering 6.5 4.0 9.0 46.7s 40.0s 119.1s
Stormbringer: Sundering 0.7 0.0 5.0 107.1s 40.0s 344.1s
Windfury: Sundering 2.5 0.0 7.0 87.0s 40.0s 341.7s
Flametongue: Windstrike 27.0 17.0 46.0 10.0s 0.8s 171.4s
Stormbringer: Windstrike 2.8 0.0 11.0 58.5s 0.8s 193.8s
Windfury: Windstrike 19.1 9.0 35.0 13.7s 0.8s 177.7s
Flametongue: Windstrike Off-Hand 27.0 17.0 46.0 10.0s 0.8s 171.4s
Stormbringer: Windstrike Off-Hand 2.8 0.0 11.0 59.1s 0.8s 193.4s
Flametongue: Lava Lash 19.1 13.0 26.0 15.0s 8.7s 55.8s
Stormbringer: Lava Lash 2.0 0.0 9.0 74.8s 9.0s 336.6s
Flametongue: Ice Strike 21.2 13.0 28.0 14.1s 8.5s 63.8s
Stormbringer: Ice Strike 2.2 0.0 8.0 75.7s 9.0s 348.6s
Windfury: Ice Strike 8.1 1.0 17.0 36.1s 8.7s 262.4s
Flametongue: Stormstrike 118.1 61.0 186.0 3.2s 0.9s 28.2s
Stormbringer: Stormstrike 12.5 0.0 30.0 21.7s 0.9s 250.2s
Windfury: Stormstrike 41.3 17.0 75.0 7.7s 0.9s 96.4s
Flametongue: Stormstrike Off-Hand 118.1 61.0 186.0 3.2s 0.9s 28.2s
Stormbringer: Stormstrike Off-Hand 12.5 1.0 32.0 21.8s 0.9s 247.7s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 24.06% 17.02% 30.61% 0.7s 0.0s 19.3s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7980.0011.5199.2743.02515.761
Ascendance0.5450.0012.4330.4240.0002.433
Doom Winds0.5830.0012.6661.2850.2104.679
Sundering7.1290.00179.06037.2701.895110.359
Windstrike0.8960.0013.88817.7507.93524.610
Lava Lash3.2190.00143.40656.41419.226110.321
Flame Shock16.6350.001166.150210.89682.370303.143
Ice Strike2.5660.00151.46549.52810.238109.679
Frost Shock9.4070.001118.099172.44771.299265.785
Elemental Blast3.4200.00124.4172.1650.00024.417
Stormstrike1.0490.0015.03888.54245.035140.084
Earth Elemental6.7300.00135.5280.9160.00035.528

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana674.86253618.73100.00%375.81225769.0147.10%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 845.40 848.29 225768.5 49131.4 43000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.7434022.501375.001375.0056.94
Flame ShockMana 13.8210363.92750.00315.0843.46
Frost ShockMana 19.989987.67500.00500.0135.68
Ice StrikeMana 21.1834950.921650.001650.0012.29
Lava LashMana 19.077629.70400.00400.0052.68
Lightning BoltMana 18.129061.26500.00500.0197.33
StormstrikeMana 118.10118104.521000.001332.6417.48
SunderingMana 6.5419616.983000.003000.1215.12

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 44701.43
Minimum 36825.39
Maximum 53817.04
Spread ( max - min ) 16991.65
Range [ ( max - min ) / 2 * 100% ] 19.01%
Standard Deviation 2196.6701
5th Percentile 41321.38
95th Percentile 48489.04
( 95th Percentile - 5th Percentile ) 7167.66
Mean Distribution
Standard Deviation 25.3667
95.00% Confidence Interval ( 44651.71 - 44751.15 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9277
0.1 Scale Factor Error with Delta=300 41193
0.05 Scale Factor Error with Delta=300 164769
0.01 Scale Factor Error with Delta=300 4119205
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 44701.43
Minimum 36825.39
Maximum 53817.04
Spread ( max - min ) 16991.65
Range [ ( max - min ) / 2 * 100% ] 19.01%
Standard Deviation 2196.6701
5th Percentile 41321.38
95th Percentile 48489.04
( 95th Percentile - 5th Percentile ) 7167.66
Mean Distribution
Standard Deviation 25.3667
95.00% Confidence Interval ( 44651.71 - 44751.15 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9277
0.1 Scale Factor Error with Delta=300 41193
0.05 Scale Factor Error with Delta=300 164769
0.01 Scale Factor Error with Delta=300 4119205
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 44701.43
Minimum 36825.39
Maximum 53817.04
Spread ( max - min ) 16991.65
Range [ ( max - min ) / 2 * 100% ] 19.01%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 12580019.67
Minimum 9242600.45
Maximum 16466375.87
Spread ( max - min ) 7223775.41
Range [ ( max - min ) / 2 * 100% ] 28.71%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.52 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 20.25 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.68 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
M 2.37 ice_strike,if=buff.doom_winds.up
N 0.77 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.15 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
P 2.56 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
Q 0.01 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 70.28 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 24.74 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 4.05 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 12.66 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 18.81 ice_strike
W 16.52 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
X 14.07 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.77 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 19.98 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.15 earth_elemental
b 12.67 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKMKKNKKKFKOKKSKSRVRWXZaRRXFRSVWRZXRbZVRRSRWZYbUSVZUFWXRRRSRVZXWRUXRSZVUbWZUFSRRVHNLLLLPSRVZXbUUSRFRRTRVWXRSZbUZVWXRYZSFRRVWXRSRRXZbVUSRWZbFRXRVSZWRXRRRDTGEHKFKKKKMKKFKKORRSRVRSRWXYZUbVUFRSRRRRSRVWXRZbXUZVUFRRRSRRRPRSRRVRSRFRRTRWRHMLLLNSRWZbFRRRSRVRWSR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), crumbling_power(20), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:00.953 default G ascendance Fluffy_Pillow 40774.8/50000: 82% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:01.905 default E berserking Fluffy_Pillow 42298.0/50000: 85% mana bloodlust, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:01.905 default H doom_winds Fluffy_Pillow 42298.0/50000: 85% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:02.773 single K windstrike Fluffy_Pillow 43686.8/50000: 87% mana bloodlust, berserking, ascendance, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.639 single M ice_strike Fluffy_Pillow 45072.4/50000: 90% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds, crumbling_power(17), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:04.506 single K windstrike Fluffy_Pillow 44809.6/50000: 90% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(16), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.373 single K windstrike Fluffy_Pillow 46196.8/50000: 92% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.241 single N sundering Fluffy_Pillow 47585.6/50000: 95% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.109 single K windstrike Fluffy_Pillow 45974.4/50000: 92% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.976 single K windstrike Fluffy_Pillow 47361.6/50000: 95% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.843 single K windstrike Fluffy_Pillow 48748.8/50000: 97% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.712 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.580 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.448 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.315 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.184 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.052 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.006 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.960 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.914 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.869 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.822 single R stormstrike Fluffy_Pillow 49874.8/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.775 single W lava_lash Fluffy_Pillow 49399.6/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.729 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.681 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.635 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.588 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.543 single R stormstrike Fluffy_Pillow 49528.0/50000: 99% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.496 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.451 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.404 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.359 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.311 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.238 single W lava_lash Fluffy_Pillow 49833.2/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:31.164 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, elemental_chaos_frost
0:32.090 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, elemental_chaos_frost
0:33.015 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_frost
0:33.939 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
0:34.865 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
0:35.790 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
0:36.714 Waiting     1.582 sec 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
0:38.296 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_frost
0:39.488 single R stormstrike Fluffy_Pillow 49874.8/50000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_frost
0:40.440 single R stormstrike Fluffy_Pillow 49398.0/50000: 99% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_frost
0:41.678 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_frost
0:42.916 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), stormbringer, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:44.154 single W lava_lash Fluffy_Pillow 49980.8/50000: 100% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:45.393 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:46.632 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
0:47.872 single b flame_shock Fluffy_Pillow 48984.0/50000: 98% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), elemental_chaos_frost
0:49.109 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), elemental_chaos_frost
0:50.348 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(5), elemental_chaos_frost
0:51.587 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), elemental_chaos_frost
0:52.825 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), ice_strike, elemental_chaos_frost
0:54.064 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, stormbringer, maelstrom_weapon(3), elemental_chaos_frost
0:55.300 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, maelstrom_weapon(5), elemental_chaos_frost
0:56.540 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_frost
0:57.779 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_frost
0:59.018 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
1:00.257 single R stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:01.495 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:02.731 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:03.970 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:05.172 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:06.375 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:07.578 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:08.780 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), forgestorm_ignited, elemental_chaos_earth
1:09.981 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, forgestorm_ignited, elemental_chaos_earth
1:11.184 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
1:12.387 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
1:13.590 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:14.828 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:16.066 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
1:17.304 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:18.542 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon, ice_strike, sophic_devotion, elemental_chaos_earth
1:19.780 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_earth
1:21.019 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_earth
1:22.258 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_earth
1:23.497 Waiting     1.020 sec 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
1:24.517 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
1:25.954 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(6), sophic_devotion, elemental_chaos_earth
1:27.193 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), sophic_devotion, elemental_chaos_earth
1:28.431 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:29.634 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:30.837 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:32.040 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:33.243 single N sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), doom_winds, ice_strike, elemental_chaos_earth
1:34.444 single L stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, ice_strike, elemental_chaos_earth
1:35.646 single L stormstrike Fluffy_Pillow 49844.8/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds, elemental_chaos_earth
1:36.849 single L stormstrike Fluffy_Pillow 49769.6/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(2), elemental_chaos_earth
1:38.050 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(2), elemental_chaos_earth
1:39.288 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(3), elemental_chaos_earth
1:40.525 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(4), elemental_chaos_earth
1:41.763 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
1:42.965 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
1:44.167 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
1:45.371 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
1:46.574 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, spiraling_winds(7), elemental_chaos_earth
1:47.777 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, spiraling_winds(7), elemental_chaos_earth
1:48.981 single U stormstrike Fluffy_Pillow 49926.4/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(3), spiraling_winds(8), elemental_chaos_earth
1:50.183 single S elemental_blast Fluffy_Pillow 49849.6/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(5), spiraling_winds(8), elemental_chaos_earth
1:51.387 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), stormbringer, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
1:52.590 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:53.793 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:54.996 single R stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:56.199 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth
1:57.401 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:58.605 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:59.806 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:01.008 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:02.246 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:03.486 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:04.724 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:05.926 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:07.129 Waiting     0.956 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:08.085 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:09.476 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:10.723 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:11.926 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(5), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:13.127 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(6), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:14.328 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:15.569 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:16.807 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana forceful_winds, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:18.046 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:19.284 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, spiraling_winds(10), elemental_chaos_fire
2:20.523 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, spiraling_winds(10), elemental_chaos_fire
2:21.760 single R stormstrike Fluffy_Pillow 48979.2/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
2:22.999 single V ice_strike Fluffy_Pillow 49961.6/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_fire
2:24.237 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:25.476 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), ice_strike, elemental_chaos_fire
2:26.714 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:27.952 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:29.190 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:30.427 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:31.664 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:32.901 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:34.139 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
2:35.376 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
2:36.614 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
2:37.854 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
2:39.291 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, stormbringer, ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
2:40.529 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
2:41.767 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
2:43.005 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
2:44.243 Waiting     0.203 sec 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
2:44.446 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(4), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
2:45.685 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
2:46.922 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
2:48.161 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
2:49.399 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_fire
2:50.638 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_fire
2:51.879 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:53.118 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), spiraling_winds(10), elemental_chaos_fire
2:54.357 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, spiraling_winds(10), elemental_chaos_fire
2:55.594 single X lightning_bolt Fluffy_Pillow 49979.2/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_fire
2:56.834 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:58.073 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:59.313 single R stormstrike Fluffy_Pillow 48984.0/50000: 98% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:00.554 default D use_items Fluffy_Pillow 49969.6/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
3:00.554 single T lightning_bolt Fluffy_Pillow 49969.6/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(10), elemental_chaos_earth
3:01.792 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(10), elemental_chaos_earth
3:03.031 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(2), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:03.031 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), forceful_winds(2), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:04.159 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), forceful_winds(4), maelstrom_weapon(5), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:05.285 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(4), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:06.412 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds, crumbling_power(16), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:07.539 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(15), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:08.663 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:09.790 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:10.916 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:12.042 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:13.167 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:14.293 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:15.419 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:16.685 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:17.924 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(4), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
3:19.162 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(4), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10), elemental_chaos_earth
3:20.400 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(10), elemental_chaos_earth
3:21.637 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_earth
3:22.876 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
3:24.115 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
3:25.352 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:26.591 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:27.830 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:29.070 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:30.309 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:31.548 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:32.787 single Z frost_shock Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_mastery, forceful_winds, ice_strike, elemental_chaos_earth
3:34.022 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, maelstrom_weapon, elemental_chaos_earth
3:35.260 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), elemental_chaos_earth
3:36.500 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), elemental_chaos_earth
3:37.738 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_earth
3:38.976 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_earth
3:40.215 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
3:41.453 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), ice_strike, elemental_chaos_earth
3:42.689 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:43.927 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:45.166 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
3:46.403 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
3:47.641 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(2), elemental_chaos_earth
3:48.880 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
3:50.083 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
3:51.285 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
3:52.486 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
3:53.690 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
3:54.892 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
3:56.097 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
3:57.301 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
3:58.502 Waiting     1.037 sec 50000.0/50000: 100% mana flurry(2), forceful_winds(2), spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
3:59.539 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
4:00.980 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:02.218 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:03.455 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(3), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:04.693 default F feral_spirit Fluffy_Pillow 48980.8/50000: 98% mana flurry, forceful_winds(5), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:05.932 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:07.169 single R stormstrike Fluffy_Pillow 48979.2/50000: 98% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:08.408 single R stormstrike Fluffy_Pillow 49961.6/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:09.647 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:10.884 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
4:12.086 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:13.289 single R stormstrike Fluffy_Pillow 47924.8/50000: 96% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:14.493 single P lava_lash Fluffy_Pillow 48851.2/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:15.695 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:16.896 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:18.099 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:19.301 single R stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:20.503 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:21.705 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:22.908 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:24.111 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
4:25.315 default F feral_spirit Fluffy_Pillow 48926.4/50000: 98% mana flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:26.518 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:27.720 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:28.922 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_earth
4:30.124 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:31.326 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:32.529 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_earth
4:33.733 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_chaos_earth
4:34.971 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, elemental_chaos_earth
4:36.210 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_earth
4:37.449 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds, elemental_chaos_earth
4:38.687 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds, elemental_chaos_earth
4:39.926 single N sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(2), elemental_chaos_earth
4:41.164 single S elemental_blast Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), forceful_winds(2), maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(3), elemental_chaos_earth
4:42.402 single R stormstrike Fluffy_Pillow 49586.6/50000: 99% mana flurry, elemental_blast_mastery, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
4:43.642 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
4:44.881 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
4:46.120 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
4:47.359 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_earth
4:48.597 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(6), elemental_chaos_earth
4:49.835 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
4:51.074 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
4:52.312 single S elemental_blast Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
4:53.551 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
4:54.791 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
4:56.029 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:57.266 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:58.504 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:59.742 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [33]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 309584044
Max Event Queue: 395
Sim Seconds: 2250297
CPU Seconds: 317.1920
Physical Seconds: 159.0391
Speed Up: 7094

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.35sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 155881 520 7.66 3191 6443 38.3 38.3 27.1% 0.0% 0.0% 0.0% 6.90sec 155881 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 65.92sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 134.72sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 766734 2556 38.50 3572 7187 192.5 192.5 27.5% 16.3% 0.0% 0.0% 1.82sec 1095362 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 372792 1243 37.62 1786 3593 188.1 188.1 27.5% 16.8% 0.0% 0.0% 1.82sec 532573 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.81sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3365002 11217 40.17 13103 26328 200.9 200.9 27.6% 0.0% 0.0% 0.0% 1.41sec 3365002 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 201858 673 0.53 59537 120021 2.8 2.7 27.4% 0.0% 0.0% 0.0% 119.80sec 201858 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 6021 20 2.30 410 822 1.1 11.5 27.5% 0.0% 0.0% 0.0% 114.57sec 6021 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 317743 1059 1.50 33425 67192 7.5 7.5 26.9% 0.0% 0.0% 0.0% 30.14sec 453930 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 85.77sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 645287 2151 19.75 5111 10269 68.3 98.8 27.6% 0.0% 0.0% 0.0% 4.38sec 645287 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 242767 809 4.28 8888 17845 21.4 21.4 27.4% 0.0% 0.0% 0.0% 7.96sec 242767 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 121360 405 4.28 4443 8927 21.4 21.4 27.3% 0.0% 0.0% 0.0% 7.96sec 121360 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 60.97sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 1988826 6629 13.65 22791 45885 68.3 68.3 27.4% 0.0% 0.0% 0.0% 4.38sec 1988826 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 416770 1389 13.62 4787 9620 68.1 68.1 27.5% 0.0% 0.0% 0.0% 4.39sec 416770 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 457719 1526 12.85 5580 11218 64.2 64.2 27.4% 0.0% 0.0% 0.0% 4.62sec 653901 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 229005 763 12.85 2788 5617 64.2 64.2 27.4% 0.0% 0.0% 0.0% 4.62sec 327158 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1216767 4056 8.79 0 27670 44.0 44.0 100.0% 0.0% 0.0% 0.0% 6.73sec 1216767 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 608383 2028 8.79 0 13835 44.0 44.0 100.0% 0.0% 0.0% 0.0% 6.73sec 608383 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 39.70sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.51sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.49sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1595427 5318 49.31 5059 10188 246.5 246.5 27.5% 0.0% 0.0% 0.0% 1.21sec 1595427 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 60063 200 4.06 2314 4651 20.3 20.3 27.7% 0.0% 0.0% 0.0% 14.36sec 85807 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 59911 200 4.06 2314 4651 20.3 20.3 27.4% 0.0% 0.0% 0.0% 14.39sec 85590 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.3 0.0 0.0% 0.0% 0.0% 0.0% 14.36sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 97019 592 19.21 1449 2898 52.5 52.5 27.5% 0.0% 0.0% 0.0% 5.36sec 138603 163.99sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 185 1 1.07 50 99 2.9 2.9 27.4% 0.0% 0.0% 0.0% 120.50sec 264 163.99sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 198289 1209 34.91 1628 3256 95.4 95.4 27.7% 0.0% 0.0% 0.0% 2.90sec 283277 163.99sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.50sec 0 163.99sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.86sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.12sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 63322 211 1.39 7856 15779 6.9 6.9 16.1% 0.0% 0.0% 0.0% 45.71sec 63322 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 833664 2779 30.73 4662 9374 153.6 153.6 16.2% 0.0% 0.0% 0.0% 2.35sec 1190979 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.93sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 57421 191 1.40 7053 14179 7.0 7.0 16.5% 0.0% 0.0% 0.0% 45.86sec 57421 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1378458 4595 19.85 11928 23971 99.3 99.3 16.3% 0.0% 0.0% 0.0% 2.99sec 1378458 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 406630 1355 27.05 3006 0 0.0 135.3 0.0% 0.0% 0.0% 0.0% 0.00sec 406630 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 270211 901 1.38 33622 67587 6.9 6.9 16.3% 0.0% 0.0% 0.0% 46.83sec 386025 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.98sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 332582 1109 5.24 10892 21900 26.2 26.2 16.3% 0.0% 0.0% 0.0% 11.08sec 475129 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 538457 1795 21.15 4376 8792 105.7 105.7 16.2% 0.0% 0.0% 0.0% 3.46sec 538457 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 23521 78 2.32 1739 3484 11.6 11.6 16.3% 0.0% 0.0% 0.0% 27.04sec 23521 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.89sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike 55090 298433 995 15.81 3245 6526 79.0 79.0 16.2% 0.0% 0.0% 0.0% 3.70sec 426344 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike_shadow 70890 396679 1322 15.81 4316 8663 0.0 79.0 16.2% 0.0% 0.0% 0.0% 0.00sec 396679 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 144480 482 3.11 7981 16034 15.6 15.6 16.2% 0.0% 0.0% 0.0% 6.91sec 144480 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 692088 2307 3.11 38268 76828 15.6 15.6 16.2% 0.0% 0.0% 0.0% 6.91sec 692088 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.59sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 59104 197 0.73 13910 27974 3.6 3.6 16.4% 0.0% 0.0% 0.0% 91.66sec 59104 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_pact 319236 381037 1270 24.55 2667 5357 122.7 122.7 16.2% 0.0% 0.0% 0.0% 2.65sec 381037 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.6 0.0 0.0% 0.0% 0.0% 0.0% 13.58sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 251889 840 19.90 2174 4367 11.6 99.5 16.3% 0.0% 0.0% 0.0% 27.04sec 251889 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 89198 297 7.59 2026 4044 37.9 37.9 16.1% 0.0% 0.0% 0.0% 7.83sec 127429 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 26 0 0.07 69 138 0.3 0.3 17.1% 0.0% 0.0% 0.0% 90.14sec 38 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1232182 4107 38.65 5488 10959 193.3 193.3 16.2% 0.0% 0.0% 0.0% 1.54sec 1760305 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul monstrous_blow 91797 9071 30 0.67 2333 4668 3.3 3.3 16.2% 0.0% 0.0% 0.0% 91.19sec 12958 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 393288 1311 13.77 4920 9825 68.9 68.9 16.1% 0.0% 0.0% 0.0% 4.25sec 393288 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1570204 31404 48.51 33466 66669 40.4 40.4 16.2% 0.0% 0.0% 0.0% 5.16sec 1570204 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.59sec 0 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_risen_skulker skulker_shot 212423 338730 1129 31.03 1880 3755 155.2 155.1 16.2% 0.0% 0.0% 0.0% 1.92sec 483912 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 260857 4455 220.55 1043 2083 215.2 215.2 16.3% 0.0% 0.0% 0.0% 1.00sec 372663 58.56sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1340561 22893 362.37 3262 6519 353.7 353.7 16.2% 0.0% 0.0% 0.0% 0.60sec 1915136 58.56sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.68sec 0 58.56sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.13sec 0 58.94sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.91sec 0 59.50sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.91sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 346378 3562 25.68 7161 14313 41.6 41.6 16.2% 0.0% 0.0% 0.0% 7.11sec 346378 97.24sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 840424 8643 61.36 7272 14528 99.5 99.4 16.2% 0.0% 0.0% 0.0% 2.92sec 840424 97.24sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.91sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.90sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.91sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.91sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 218169 1628 88.33 951 1902 197.3 197.3 16.2% 0.0% 0.0% 0.0% 1.43sec 311677 134.05sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 949778 7085 125.08 2926 5845 279.5 279.5 16.2% 0.0% 0.0% 0.0% 1.01sec 1356860 134.05sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.91sec 0 134.05sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 45.79sec 0 134.38sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.84sec 0 134.15sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.97sec 0 133.50sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 123.43sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.81sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 1490839 4969 10.06 24311 51996 50.3 50.3 19.2% 0.0% 0.0% 0.0% 5.96sec 3483174 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 1992335 6641 25.72 13043 26854 50.3 128.6 17.8% 0.0% 0.0% 0.0% 5.96sec 3483174 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 178.9 0.0 0.0% 0.0% 0.0% 0.0% 1.66sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo 120644 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 77.83sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 77.83sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_damage 390964 76335 254 0.70 19132 39597 3.5 3.5 13.8% 0.0% 0.0% 0.0% 77.83sec 76335 300.00sec
PR_Priest_Shadow PR_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_void_tendril mind_flay ticks -193473 835554 2785 28.70 4995 10121 19.2 143.5 16.1% 0.0% 0.0% 0.0% 14.32sec 835554 25.68sec
PR_Priest_Shadow PR_Priest_Shadow mental_fortitude 377065 143018 477 68.16 420 0 329.9 340.8 0.0% 0.0% 0.0% 0.0% 0.90sec 6872594 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 1702293 5674 12.42 21973 46584 62.1 62.1 22.1% 0.0% 0.0% 0.0% 4.81sec 1702293 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 105831 353 3.71 4980 10088 3.1 18.5 14.2% 0.0% 0.0% 0.0% 62.06sec 105831 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay_insanity ticks -391403 2083437 6945 29.68 11970 24439 37.3 148.4 16.6% 0.0% 0.0% 0.0% 7.92sec 2083437 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 263278 878 1.71 26511 56500 8.5 8.5 14.4% 0.0% 0.0% 0.0% 28.48sec 263278 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.84sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames 375901 410166 1367 1.53 43250 94795 7.7 7.7 20.0% 0.0% 0.0% 0.0% 40.68sec 410166 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 40.68sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 304.13sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.64sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 35.62sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 320652 1069 1.78 30147 64125 8.9 8.9 17.1% 0.0% 0.0% 0.0% 35.52sec 320652 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 35.62sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 197325 658 25.90 1524 0 130.6 129.5 0.0% 0.0% 0.0% 0.0% 2.24sec 197325 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 353299 1178 2.37 24594 50449 11.9 11.9 20.1% 0.0% 0.0% 0.0% 26.36sec 353299 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 90047 300 2.35 5053 18285 11.9 11.8 19.6% 0.0% 0.0% 0.0% 26.36sec 240532 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 911445 3038 50.33 3057 6252 17.2 251.6 17.7% 0.0% 0.0% 0.0% 17.53sec 911445 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 112.0 0.0 0.0% 0.0% 0.0% 0.0% 2.66sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparition 148859 396164 1321 21.73 3646 0 110.4 108.7 0.0% 0.0% 0.0% 0.0% 2.65sec 396164 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 375166 1251 17.24 4352 0 7.2 86.2 0.0% 0.0% 0.0% 0.0% 37.40sec 375166 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.39sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 1088739 3629 33.02 5567 11393 17.2 165.1 17.6% 0.0% 0.0% 0.0% 17.53sec 1088739 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 165.1 0.0 0.0% 0.0% 0.0% 0.0% 1.80sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow void_torrent ticks -263165 921614 3072 5.74 26331 53683 4.9 28.7 21.2% 0.0% 0.0% 0.0% 65.77sec 921614 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 41.1 0.0 0.0% 0.0% 0.0% 0.0% 7.11sec 0 137.71sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment_damage 373442 848935 6164 17.92 16416 34196 41.1 41.1 23.8% 0.0% 0.0% 0.0% 7.11sec 848935 137.71sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender melee 0 720851 5234 56.89 4483 9098 130.6 130.6 22.5% 0.0% 0.0% 0.0% 2.24sec 720851 137.71sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 310.10sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2413817 8046 4.18 95039 191343 20.9 20.9 21.1% 0.0% 0.0% 0.0% 14.22sec 2413817 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.05sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 603566 2012 16.80 6117 12289 84.0 84.0 17.3% 0.0% 0.0% 0.0% 3.57sec 1419512 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 815945 2720 38.44 3612 7261 84.0 192.2 17.4% 0.0% 0.0% 0.0% 3.57sec 1419512 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 277199 924 135.34 349 700 676.7 676.7 17.4% 0.0% 0.0% 0.0% 0.72sec 277199 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 329721 1099 5.72 9806 19717 28.6 28.6 17.3% 0.0% 0.0% 0.0% 7.71sec 329721 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1577000 5257 7.96 33642 67691 39.8 39.8 17.6% 0.0% 0.0% 0.0% 7.51sec 1577000 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 564832 1883 4.91 19595 39348 24.5 24.5 17.4% 0.0% 0.0% 0.0% 12.34sec 564832 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2760123 9200 13.59 34568 69371 68.0 68.0 17.4% 0.0% 0.0% 0.0% 4.36sec 2760123 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 994243 3314 3.24 50420 101354 16.2 16.2 21.3% 0.0% 0.0% 0.0% 18.74sec 994243 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 519255 1731 38.67 2654 5331 193.4 193.4 17.4% 16.3% 0.0% 0.0% 1.81sec 741811 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 260039 867 38.67 1329 2671 193.4 193.4 17.4% 16.4% 0.0% 0.0% 1.80sec 371494 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.29sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 48613 162 1.41 5898 11846 7.0 7.0 17.1% 0.0% 0.0% 0.0% 45.70sec 48613 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 807160 2691 1.40 95142 190022 7.0 7.0 21.3% 0.0% 0.0% 0.0% 45.88sec 807160 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 51.6 0.0 0.0% 0.0% 0.0% 0.0% 5.75sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 390493 1302 10.32 6443 12954 51.6 51.6 17.3% 0.0% 0.0% 0.0% 5.75sec 557862 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 195412 651 10.32 3221 6481 51.6 51.6 17.4% 0.0% 0.0% 0.0% 5.75sec 279167 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 233335 778 1.15 34564 69662 5.7 5.7 17.5% 0.0% 0.0% 0.0% 53.70sec 233335 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 214358 715 30.35 1202 2415 151.8 151.8 17.4% 0.0% 0.0% 0.0% 4.06sec 306234 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 25583 413 38.78 545 1089 40.0 40.0 17.4% 0.0% 0.0% 0.0% 2.25sec 36548 61.89sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 200770 4222 112.71 1915 3827 89.3 89.3 17.4% 0.0% 0.0% 0.0% 3.41sec 286821 47.55sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 201112 3899 104.14 1913 3824 89.5 89.5 17.4% 0.0% 0.0% 0.0% 3.40sec 287310 51.58sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 200106 3850 102.88 1913 3821 89.1 89.1 17.4% 0.0% 0.0% 0.0% 3.41sec 285873 51.98sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 30.91sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 307703 1026 1.67 30754 61821 8.4 8.4 19.3% 0.0% 0.0% 0.0% 30.91sec 307703 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 23159 77 0.75 6206 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 33085 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 308.81sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2087753 6959 5.03 68620 137579 25.1 25.1 21.0% 0.0% 0.0% 0.0% 11.75sec 2087753 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 21.13sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 95883 320 5.97 2733 5486 29.8 29.8 17.4% 0.0% 0.0% 0.0% 9.87sec 451226 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 355343 1184 37.37 1619 3253 29.8 186.8 17.3% 0.0% 0.0% 0.0% 9.87sec 451226 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 450170 1501 225.92 339 681 1129.6 1129.6 17.3% 0.0% 0.0% 0.0% 0.67sec 450170 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 332637 1109 5.76 9807 19718 28.8 28.8 17.5% 0.0% 0.0% 0.0% 7.66sec 332637 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 303639 1012 3.30 15653 31495 16.5 16.5 17.5% 0.0% 0.0% 0.0% 16.92sec 303639 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 414500 1382 4.03 17517 35161 20.2 20.2 17.3% 0.0% 0.0% 0.0% 14.97sec 414500 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 395626 1319 3.70 18165 36470 18.5 18.5 17.4% 0.0% 0.0% 0.0% 15.78sec 395626 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 838230 2794 3.33 41290 82908 16.7 16.7 21.6% 0.0% 0.0% 0.0% 16.90sec 838230 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 1 436778 1456 32.58 2652 5332 162.9 162.9 17.3% 16.4% 0.0% 0.0% 2.14sec 623985 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 2 224042 747 33.31 1329 2670 166.6 166.6 17.4% 16.3% 0.0% 0.0% 2.08sec 320068 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.42sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 92.2 0.0 0.0% 0.0% 0.0% 0.0% 3.24sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1228015 4093 24.58 8506 17077 122.9 122.9 17.3% 0.0% 0.0% 0.0% 3.24sec 1754352 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 291631 972 12.26 4758 0 61.3 61.3 0.0% 0.0% 0.0% 0.0% 5.48sec 291631 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 614367 2048 24.58 4252 8551 122.9 122.9 17.4% 0.0% 0.0% 0.0% 3.24sec 877690 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 145771 486 12.26 2378 0 61.3 61.3 0.0% 0.0% 0.0% 0.0% 5.48sec 145771 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 301761 1006 1.27 40444 80915 6.4 6.4 17.1% 0.0% 0.0% 0.0% 49.33sec 301761 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2070373 6901 83.45 4228 8483 417.2 417.2 17.3% 0.0% 0.0% 0.0% 2.40sec 2957751 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 155497 518 6.75 3804 7638 33.7 33.7 21.0% 0.0% 0.0% 0.0% 8.51sec 155497 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 90191 301 7.81 1901 3825 39.1 39.1 21.2% 0.0% 0.0% 0.0% 7.37sec 90191 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 27.5 0.0 0.0% 0.0% 0.0% 0.0% 8.71sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 559556 1865 7.32 13035 26188 36.6 36.6 17.2% 0.0% 0.0% 0.0% 8.71sec 559556 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 100816 336 2.48 8125 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.46sec 100816 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 279590 932 7.32 6518 13086 36.6 36.6 17.1% 0.0% 0.0% 0.0% 8.71sec 279590 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 50424 168 2.48 4064 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.46sec 50424 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1082169 3607 5.50 32497 65207 27.5 27.5 21.0% 0.0% 0.0% 0.0% 8.71sec 1082169 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 26335 422 39.35 548 1096 40.9 40.9 17.3% 0.0% 0.0% 0.0% 2.40sec 37622 62.43sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 825154 7495 202.20 1897 3788 371.0 371.0 17.3% 0.0% 0.0% 0.0% 1.61sec 1178821 110.10sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.42sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 96274 321 0.40 40323 81045 2.0 2.0 19.2% 0.0% 0.0% 0.0% 180.42sec 96274 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.69sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 22907 76 0.74 6154 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.47sec 32725 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 306.09sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 1937301 6458 4.95 64724 129805 24.7 24.7 20.9% 0.0% 0.0% 0.0% 11.69sec 1937301 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 23.98sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 103852 346 6.58 2686 5394 32.9 32.9 17.4% 0.0% 0.0% 0.0% 8.85sec 450418 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 346565 1155 36.62 1611 3234 32.9 183.1 17.4% 0.0% 0.0% 0.0% 8.85sec 450418 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 434295 1448 216.72 342 685 1083.6 1083.6 17.3% 0.0% 0.0% 0.0% 0.69sec 434295 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 330048 1100 5.73 9808 19716 28.6 28.6 17.3% 0.0% 0.0% 0.0% 7.70sec 330048 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 356395 1188 3.99 15178 30483 20.0 20.0 17.4% 0.0% 0.0% 0.0% 13.86sec 356395 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 429374 1431 4.24 17253 34552 21.2 21.2 17.4% 0.0% 0.0% 0.0% 14.15sec 429374 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 401949 1340 3.81 17893 35990 19.1 19.1 17.6% 0.0% 0.0% 0.0% 14.97sec 401949 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 881898 2940 3.62 40023 80376 18.1 18.1 21.4% 0.0% 0.0% 0.0% 15.36sec 881898 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 1 449321 1498 34.42 2581 5192 172.1 172.1 17.3% 16.4% 0.0% 0.0% 1.93sec 641904 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 2 227600 759 34.76 1295 2603 173.8 173.8 17.4% 16.4% 0.0% 0.0% 2.01sec 325152 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 88.6 0.0 0.0% 0.0% 0.0% 0.0% 3.21sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1117409 3725 23.62 8042 16214 118.1 118.1 17.4% 0.0% 0.0% 0.0% 3.21sec 1596340 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 259277 864 11.59 4473 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.45sec 259277 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 558564 1862 23.62 4023 8087 118.1 118.1 17.4% 0.0% 0.0% 0.0% 3.21sec 797969 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 129557 432 11.59 2235 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.45sec 129557 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 296578 989 1.31 38573 77416 6.5 6.5 17.5% 0.0% 0.0% 0.0% 46.76sec 296578 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2049148 6831 81.62 4286 8559 408.1 408.1 17.2% 0.0% 0.0% 0.0% 2.46sec 2927429 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 132590 442 4.79 4572 9201 24.0 24.0 20.8% 0.0% 0.0% 0.0% 10.21sec 132590 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 69982 233 5.05 2291 4605 25.2 25.2 20.8% 0.0% 0.0% 0.0% 9.69sec 69982 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 20.3 0.0 0.0% 0.0% 0.0% 0.0% 10.01sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 536114 1787 5.41 16968 33986 27.0 27.0 16.8% 0.0% 0.0% 0.0% 10.01sec 536114 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 120283 401 2.33 10327 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.80sec 120283 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 267952 893 5.41 8479 17042 27.0 27.0 16.7% 0.0% 0.0% 0.0% 10.01sec 267952 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 60049 200 2.33 5156 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.80sec 60049 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 964734 3216 4.05 39342 78958 20.3 20.3 20.9% 0.0% 0.0% 0.0% 10.02sec 964734 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 24821 401 38.21 537 1075 39.4 39.4 17.3% 0.0% 0.0% 0.0% 2.42sec 35459 61.83sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 771932 13584 361.91 1922 3835 342.8 342.8 17.3% 0.0% 0.0% 0.0% 1.73sec 1102788 56.83sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
272720.4 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.2sec 18.7sec 5.5sec 23.02% 23.12% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 207.0s
  • trigger_min/max:3.0s / 207.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.02%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.8sec 5.5sec 23.21% 23.34% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 186.0s
  • trigger_min/max:3.0s / 186.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.21%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 9.5 2.4 33.6sec 26.3sec 7.2sec 22.86% 0.00% 2.4 (2.4) 9.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.4s / 70.2s
  • trigger_min/max:0.9s / 70.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s

Stack Uptimes

  • death_and_madness_death_check_1:22.86%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 119.2 139.9sec 2.5sec 285.3sec 98.65% 0.00% 109.8 (109.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.1s / 328.4s
  • trigger_min/max:0.0s / 19.2s
  • trigger_pct:100.00%
  • duration_min/max:4.7s / 356.8s

Stack Uptimes

  • death_rot_1:0.31%
  • death_rot_2:0.83%
  • death_rot_3:0.44%
  • death_rot_4:0.50%
  • death_rot_5:0.41%
  • death_rot_6:0.57%
  • death_rot_7:0.46%
  • death_rot_8:0.52%
  • death_rot_9:0.45%
  • death_rot_10:94.16%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 4.2 242.4 78.3sec 1.2sec 70.6sec 98.36% 98.28% 205.5 (205.5) 3.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 345.9s
  • trigger_min/max:0.0s / 16.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 352.3s

Stack Uptimes

  • everfrost_1:1.40%
  • everfrost_2:1.39%
  • everfrost_3:1.38%
  • everfrost_4:1.38%
  • everfrost_5:1.37%
  • everfrost_6:1.37%
  • everfrost_7:1.36%
  • everfrost_8:1.36%
  • everfrost_9:1.35%
  • everfrost_10:86.01%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 18.0 43.8 16.5sec 4.8sec 14.5sec 86.69% 99.06% 5.2 (5.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 119.0s
  • trigger_min/max:0.0s / 28.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 115.8s

Stack Uptimes

  • festering_wound_1:17.78%
  • festering_wound_2:22.25%
  • festering_wound_3:18.42%
  • festering_wound_4:11.67%
  • festering_wound_5:8.27%
  • festering_wound_6:8.30%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 67.0 5.1sec 4.4sec 295.4sec 98.45% 98.20% 67.0 (67.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 5.1s
  • trigger_min/max:0.8s / 15.5s
  • trigger_pct:100.00%
  • duration_min/max:230.6s / 359.1s

Stack Uptimes

  • lashing_flames_1:98.45%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 67.1 194.5sec 4.4sec 288.7sec 99.21% 0.00% 63.0 (63.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 351.8s
  • trigger_min/max:0.9s / 47.9s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 358.0s

Stack Uptimes

  • razorice_1:1.00%
  • razorice_2:0.80%
  • razorice_3:0.90%
  • razorice_4:0.84%
  • razorice_5:95.67%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 277255.93
Minimum 254779.73
Maximum 303651.77
Spread ( max - min ) 48872.04
Range [ ( max - min ) / 2 * 100% ] 8.81%
Standard Deviation 6783.4398
5th Percentile 266355.92
95th Percentile 288696.96
( 95th Percentile - 5th Percentile ) 22341.03
Mean Distribution
Standard Deviation 78.3336
95.00% Confidence Interval ( 277102.40 - 277409.47 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2300
0.1 Scale Factor Error with Delta=300 392811
0.05 Scale Factor Error with Delta=300 1571244
0.01 Scale Factor Error with Delta=300 39281098
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3763
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 97119736 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.