close

SimulationCraft 623-03

for World of Warcraft 6.2.3 Live (build level 20886)

Current simulator hotfixes

General

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-09-01 Touch of the Grave now scales its damage based on 50% of the character's Attack Power or Spell Power, whichever is greater.
Touch of the Grave (effect#1) average 0.00 8.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Bestial Wrath now lasts 15 seconds (up from 10 seconds).
Bestial Wrath duration 15000.00 10000.00
2015-07-20 Serpent Sting damage increased by 25%.
Serpent Sting (effect#1) ap_coefficient 0.91 0.73
2015-07-20 Black Arrow damage increased by 25%.
Black Arrow (effect#1) ap_coefficient 0.71 0.57

Item

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-11-18 Infallible Tracking Charm now has a massively increased damage and chance to trigger, but now only increases damage against demons for 5 seconds (down from 10 seconds.)
Demonbane rppm 3.00 0.96

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Dragon's Breath damage increased by 150%
Dragon's Breath (effect#1) sp_coefficient 2.15 0.86
2015-07-20 Flamestrike DOT damage increased by 50%
Flamestrike (effect#2) sp_coefficient 0.15 0.10
2015-07-20 Flamestrike impact damage increased by 50%
Flamestrike (effect#1) sp_coefficient 1.17 0.78

Paladin

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-01-30 Hammer of Wrath did not receive a 8% damage buff in 6.2.3.
Hammer of Wrath (effect#1) sp_coefficient 2.40 2.59

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Ascendance now has a 2-minute cooldown (down from 3 minutes) for Elemental Shaman.
Ascendance cooldown 120000.00 180000.00
2015-07-20 Mastery: Molten Earth damage has been increased by 11%.
Molten Earth (effect#1) sp_coefficient 1.11 1.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Immolate damage increased by 5%.
Immolate (effect#1) sp_coefficient 0.52 0.50
2015-07-20 Conflagrate damage increased by 5%.
Conflagrate (effect#1) sp_coefficient 2.14 2.04
2015-07-20 Chaos Bolt damage increased by 5%.
Chaos Bolt (effect#1) sp_coefficient 2.39 2.28
2015-07-20 Incinerate damage increased by 5%.
Incinerate (effect#1) sp_coefficient 1.51 1.43
2015-07-20 Conflagrate damage increased by 5%.
Conflagrate (effect#1) sp_coefficient 2.14 2.04
2015-07-20 Incinerate damage increased by 5%.
Incinerate (effect#1) sp_coefficient 1.51 1.43
2015-07-20 Chaos Bolt damage increased by 5%.
Chaos Bolt (effect#1) sp_coefficient 2.39 2.28
2015-07-20 Immolate damage increased by 5%.
Immolate (effect#1) sp_coefficient 0.52 0.50
2015-07-20 Shadowburn damage increased by 5%.
Shadowburn (effect#2) sp_coefficient 3.57 3.40

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Death_Knight_Frost_1h_T18H : 116173 dps, 64622 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
116172.8 116172.8 43.9 / 0.038% 7643.0 / 6.6% 13566.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.5 Runic Power 3.17% 67.8 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% M-Count M-Hit M-Crit M-Crit% Up%
Death_Knight_Frost_1h_T18H 116173
auto_attack_mh 4307 3.7% 295.2 1.53sec 6568 4309 Direct 295.2 5808 12297 5515 12.5% 19.0% 156.6 1743 3689 12.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 295.15 295.15 0.00 0.00 1.5242 0.0000 1938669.76 2979429.32 34.93 4309.47 4309.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.56 12.48% 3689.27 2744 5266 3690.83 3202 4434 72150 110884 34.93
multistrike 137.09 87.52% 1742.55 1372 2484 1743.23 1649 1852 238884 367128 34.93
hit 202.13 68.48% 5807.89 4573 8279 5810.34 5558 6125 1173937 1804155 34.93
crit 36.90 12.50% 12296.95 9145 17552 12301.83 11231 13550 453698 697262 34.93
miss 56.13 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2151 1.9% 294.7 1.53sec 3286 2152 Direct 294.7 2904 6150 2759 12.5% 19.0% 156.5 871 1845 12.5%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 294.68 294.68 0.00 0.00 1.5273 0.0000 968353.71 1488206.76 34.93 2151.61 2151.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.62 12.54% 1844.98 1372 2633 1845.76 1600 2201 36197 55629 34.93
multistrike 136.87 87.46% 871.32 686 1242 871.69 820 922 119259 183283 34.93
hit 201.82 68.49% 2903.85 2286 4140 2905.11 2770 3050 586059 900681 34.93
crit 36.88 12.52% 6150.16 4573 8776 6152.54 5533 6700 226838 348614 34.93
miss 55.98 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blood Boil 820 0.7% 13.0 33.59sec 28404 28278 Direct 52.0 5201 11025 5933 12.6% 0.0% 34.2 1560 3309 12.5%  

Stats details: blood_boil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 52.01 0.00 0.00 1.0045 0.0000 369334.65 369334.65 0.00 28277.67 28277.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.28 12.52% 3309.30 2410 5129 3262.51 0 5129 14154 14154 0.00
multistrike 29.87 87.48% 1560.03 1205 2420 1560.16 1316 1829 46604 46604 0.00
hit 45.47 87.43% 5200.71 4016 8065 5201.94 4465 5892 236496 236496 0.00
crit 6.54 12.57% 11025.28 8033 17098 11009.83 0 15983 72080 72080 0.00
 
 

Action details: blood_boil

Static Values
  • id:50842
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:dot.blood_plague.ticking&(!talent.unholy_blight.enabled|cooldown.unholy_blight.remains<49)
Spelldata
  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=1} Shadow damage to all enemies within $A1 yards, and spreads your existing diseases from your target to all other enemies hit{$?s49509=false}[, refreshing them to full duration. Also increases the healing from your next Death Strike by {$50421s1=20}%][].{$?s56835=false}[ The Rune spent on this ability will become a Death Rune when it activates. Death Runes count as any type of Rune.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.528000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
 
Blood Plague 3478 3.0% 31.9 13.40sec 49096 0 Periodic 448.3 2562 5431 2921 12.5% 0.0% 294.1 769 1628 12.5% 296.2%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.93 31.93 448.35 448.35 0.0000 2.9760 1567544.65 1567544.65 0.00 1174.81 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 36.8 12.51% 1628.26 2 2526 1628.49 1394 1838 59896 59896 0.00
multistrike 257.4 87.49% 768.70 1 1191 768.73 711 831 197835 197835 0.00
hit 392.2 87.47% 2561.92 3 3972 2562.00 2392 2745 1004723 1004723 0.00
crit 56.2 12.53% 5431.08 14 8420 5431.60 4835 5999 305091 305091 0.00
 
 

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for {$d=30 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.260040
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:30.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Defile 11745 10.1% 14.9 31.32sec 354510 352940 Direct 649.2 5968 12627 6803 12.5% 0.0% 386.5 1972 4167 12.5%  

Stats details: defile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.91 649.16 589.54 0.00 1.0045 1.0000 5284222.89 5284222.89 0.00 8741.30 352940.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 48.35 12.51% 4167.40 2507 7333 4171.18 3610 4762 201516 201516 0.00
multistrike 338.14 87.49% 1971.51 1254 3459 1973.33 1786 2167 666651 666651 0.00
hit 567.82 87.47% 5968.31 0 11530 5973.94 5337 6579 3388956 3388956 0.00
crit 81.34 12.53% 12626.65 0 24443 12637.83 10429 14895 1027100 1027100 0.00
 
 

Action details: defile

Static Values
  • id:152280
  • school:shadowfrost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152280
  • name:Defile
  • school:shadowfrost
  • tooltip:
  • description:Defiles the ground targeted by the Death Knight. Every $t3 sec, if there are any enemies standing in the Defile, it deals {$156000s1=1} Shadowfrost damage to them, and grows in radius and damage by ${$m2/100}.1%. $?c1[ Enemies standing in your Defile deal {$s4=10}% less damage to you.][] Replaces Death and Decay.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.366300
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
 
Fel Burn 8078 7.0% 115.9 7.98sec 31397 0 Periodic 1708.3 1561 3308 1779 12.5% 0.0% 1121.3 468 993 12.5% 379.2%

Stats details: fel_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.88 115.88 1708.35 1708.35 0.0000 1.0000 3638308.32 3638308.32 0.00 2129.73 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 140.3 12.51% 992.88 92 2928 993.39 727 1306 139309 139309 0.00
multistrike 981.0 87.49% 468.34 46 1381 468.56 407 513 459425 459425 0.00
hit 1494.8 87.50% 1560.93 153 4604 1561.66 1432 1658 2333315 2333315 0.00
crit 213.5 12.50% 3307.64 307 9761 3308.58 2611 4066 706259 706259 0.00
 
 

Action details: fel_burn

Static Values
  • id:184256
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184256
  • name:Fel Burn
  • school:fire
  • tooltip:Burning for $w1 Fire damage every $t1 sec. Successive attacks add stacks but do not refresh duration.
  • description:{[email protected]=Your attacks cause the target to burn for $184256o1 Fire damage over {$184256d=15 seconds}. Successive attacks do not refresh Fel Burn's duration, but instead add an additional stack of Fel Burn.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:148.79
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Fel Cleave 6911 5.9% 72.0 6.28sec 43199 0 Direct 288.1 7919 16760 9022 12.5% 0.0% 189.2 2376 5028 12.5%  

Stats details: fel_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.04 288.15 0.00 0.00 0.0000 0.0000 3111986.16 4782631.36 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 23.70 12.53% 5028.13 4751 5037 5028.03 4950 5037 119152 183118 34.93
multistrike 165.49 87.47% 2375.74 2376 2376 2375.74 2376 2376 393154 604216 34.93
hit 252.20 87.53% 7919.15 7919 7919 7919.15 7919 7919 1997235 3069434 34.93
crit 35.95 12.47% 16759.99 15838 16789 16759.51 16541 16789 602445 925864 34.93
 
 

Action details: fel_cleave

Static Values
  • id:184248
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184248
  • name:Fel Cleave
  • school:physical
  • tooltip:
  • description:{[email protected]=Your melee attacks have a chance to trigger a Fel Cleave, dealing {$184248s1=4399} damage to all enemies in front of you. (Approximately ${$procrppm}.2 procs per minute)}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11816.13
  • base_dd_max:11816.13
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Frost Fever 7083 6.1% 649.5 2.77sec 4911 0 Periodic 580.0 4031 8538 4595 12.5% 0.0% 380.6 1209 2562 12.5% 386.2%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 649.47 649.47 579.97 579.97 0.0000 3.0000 3189764.33 3189764.33 0.00 1833.29 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 649.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 47.6 12.52% 2562.27 1780 4168 2563.44 2296 2858 122077 122077 0.00
multistrike 333.0 87.48% 1209.10 890 1966 1209.63 1145 1283 402583 402583 0.00
hit 507.3 87.47% 4030.58 2967 6554 4032.27 3838 4261 2044783 2044783 0.00
crit 72.7 12.53% 8537.92 5933 13894 8541.14 7754 9389 620322 620322 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.260040
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:30.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Frost Strike 19246 16.6% 153.7 2.92sec 56396 56143 Direct 153.7 24351 51554 47111 83.7% 0.0% 101.0 7303 15466 83.6%  

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.66 153.66 0.00 0.00 1.0045 0.0000 8665796.86 8665796.86 0.00 56143.44 56143.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 84.45 83.64% 15465.99 11491 21893 15471.33 14392 16898 1306063 1306063 0.00
multistrike 16.51 16.36% 7303.16 5745 10327 7303.91 5745 9032 120591 120591 0.00
hit 25.10 16.33% 24351.13 19151 34423 24353.24 20915 29291 611137 611137 0.00
crit 128.56 83.67% 51554.15 38302 72976 51572.37 48972 54600 6628007 6628007 0.00
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:buff.killing_machine.react&main_hand.1h
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy, causing $sw1 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.88
 
Frost Strike Off-Hand 9656 8.3% 153.7 2.92sec 28296 0 Direct 153.7 12218 25867 23635 83.6% 0.0% 101.0 3664 7761 83.6%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.66 153.66 0.00 0.00 0.0000 0.0000 4347956.41 4347956.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 84.48 83.64% 7761.26 5746 10947 7764.19 7209 8346 655668 655668 0.00
multistrike 16.52 16.36% 3664.04 2873 5164 3663.83 3138 4388 60533 60533 0.00
hit 25.13 16.36% 12217.59 9577 17213 12218.26 10650 14282 307047 307047 0.00
crit 128.53 83.64% 25867.33 19154 36491 25876.60 24630 27484 3324708 3324708 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.88
 
Howling Blast 34130 29.4% 162.4 2.77sec 94650 94226 Direct 649.5 17347 36704 19772 12.5% 0.0% 426.0 5204 11012 12.5%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.37 649.47 0.00 0.00 1.0045 0.0000 15368240.22 15368240.22 0.00 94225.88 94225.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 53.34 12.52% 11012.36 7530 21159 11017.07 9776 12347 587353 587353 0.00
multistrike 372.68 87.48% 5204.08 3765 9981 5206.65 4898 5575 1939448 1939448 0.00
hit 568.12 87.47% 17347.47 12549 33269 17356.02 16431 18521 9855494 9855494 0.00
crit 81.35 12.53% 36704.30 25099 70530 36723.38 33606 40991 2985946 2985946 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever. |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {[email protected]=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
 
Obliterate 1257 1.1% 20.2 22.05sec 27952 27828 Direct 20.2 13220 27700 23327 69.8% 0.0% 13.3 3960 8318 69.9%  

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.20 20.20 0.00 0.00 1.0045 0.0000 564764.02 867953.13 34.93 27827.74 27827.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.32 69.90% 8318.39 6100 11623 8323.06 0 11623 77534 119157 34.92
multistrike 4.01 30.10% 3960.37 3050 5483 3848.11 0 5483 15895 24428 33.90
hit 6.10 30.19% 13219.69 10167 18276 13211.63 0 18276 80644 123937 34.88
crit 14.10 69.81% 27699.88 20334 38744 27719.01 24095 31785 390692 600432 34.93
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:buff.killing_machine.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack that deals $sw1 Physical damage and has a {$59057h=45}% chance to cause your next Howling Blast or Icy Touch to consume no runes.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.37
 
Obliterate Off-Hand 630 0.5% 20.2 22.05sec 14003 0 Direct 20.2 6629 13897 11691 69.7% 0.0% 13.3 1988 4170 70.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.20 20.20 0.00 0.00 0.0000 0.0000 282932.09 434821.95 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.30 69.97% 4169.94 3051 5813 4173.37 3234 5813 38771 59585 34.93
multistrike 3.99 30.03% 1988.34 1526 2742 1931.11 0 2742 7936 12196 33.91
hit 6.13 30.34% 6628.71 5085 9139 6627.63 0 9139 40641 62459 34.90
crit 14.07 69.66% 13897.21 10170 19376 13907.11 11895 16330 195584 300582 34.93
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:A brutal attack with your off-hand weapon that deals $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.37
 
Plague Strike 249 0.2% 31.9 13.40sec 3521 3505 Direct 31.9 2579 5466 2941 12.5% 0.0% 21.0 774 1638 12.5%  

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.93 31.93 0.00 0.00 1.0045 0.0000 112404.15 172747.43 34.93 3504.85 3504.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.62 12.51% 1638.21 1287 2452 1514.23 0 2452 4300 6608 32.28
multistrike 18.36 87.49% 773.86 643 1157 773.92 667 885 14204 21830 34.93
hit 27.93 87.47% 2579.22 2145 3856 2579.24 2383 2789 72028 110695 34.93
crit 4.00 12.53% 5465.90 4290 8174 5375.16 0 8174 21872 33614 34.33
 
 

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:unholy=2
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals $sw3 Physical damage and infects the target with Blood Plague{$?s51160=false}[ and Frost Fever][]. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {[email protected]=A disease that deals Shadow damage every $t1 sec for {$d=30 seconds}.} {$?s51160=false}[ |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {[email protected]=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}][]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
Plague Strike Off-Hand 125 0.1% 31.9 13.40sec 1764 0 Direct 31.9 1294 2738 1474 12.5% 0.0% 20.9 388 823 12.6%  

Stats details: plague_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.93 31.93 0.00 0.00 0.0000 0.0000 56324.82 86562.35 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.64 12.63% 822.68 643 1226 758.84 0 1226 2172 3339 32.23
multistrike 18.27 87.37% 387.94 322 578 387.89 336 450 7089 10894 34.93
hit 27.94 87.51% 1293.72 1072 1928 1293.75 1185 1407 36147 55553 34.93
crit 3.99 12.49% 2737.86 2145 4087 2687.28 0 4087 10916 16777 34.30
 
 

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66216
  • name:Plague Strike Off-Hand
  • school:physical
  • tooltip:
  • description:{[email protected]=A vicious strike that deals $sw3 Physical damage and infects the target with Blood Plague{$?s51160=false}[ and Frost Fever][]. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {[email protected]=A disease that deals Shadow damage every $t1 sec for {$d=30 seconds}.} {$?s51160=false}[ |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {[email protected]=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}][]}
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
Razorice 1522 1.3% 467.4 0.96sec 1466 0 Direct 467.4 1074 2276 1224 12.5% 0.0% 306.9 322 682 12.5%  

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 467.42 467.42 0.00 0.00 0.0000 0.0000 685031.26 685031.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 38.37 12.50% 682.33 506 971 682.64 620 769 26185 26185 0.00
multistrike 268.53 87.50% 322.16 253 458 322.30 305 342 86509 86509 0.00
hit 408.84 87.47% 1073.81 843 1527 1074.27 1032 1124 439021 439021 0.00
crit 58.58 12.53% 2275.96 1687 3237 2276.88 2097 2463 133317 133317 0.00
 
 

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{[email protected]=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=2}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.08
 
Soul Reaper 4510 3.9% 24.3 6.65sec 83415 83043 Direct 24.3 7348 15557 8370 12.4% 0.0% 15.9 2205 4669 12.5%  
Periodic 23.6 55475 117524 63256 12.5% 0.0% 15.5 16657 35269 12.5% 26.2%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.35 24.35 23.61 23.61 1.0045 5.0000 2031063.67 2161977.55 6.06 14253.38 83042.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.99 12.49% 4668.96 3484 6687 4046.08 0 6687 9300 14292 30.25
multistrike 13.95 87.51% 2204.93 1742 3154 2206.13 1859 2795 30763 47278 34.93
hit 21.32 87.55% 7348.05 5807 10514 7352.01 6567 8049 156647 240742 34.93
crit 3.03 12.45% 15556.71 11614 22291 14938.08 0 22291 47149 72461 33.53
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.9 12.53% 35269.38 25126 53490 30470.80 0 53490 68401 68401 0.00
multistrike 13.5 87.47% 16656.60 12563 25231 16663.74 13820 21833 225440 225440 0.00
hit 20.6 87.46% 55474.97 41877 84104 55510.79 50046 62310 1145406 1145406 0.00
crit 3.0 12.54% 117524.33 83755 178301 112058.48 0 178301 347957 347957 0.00
 
 

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:target.health.pct-3*(target.health.pct%target.time_to_die)<=35
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadowfrost damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.
  • description:Strikes an enemy for $sw1 Physical damage and afflicts the target with Soul Reaper. After {$d=5 seconds}, if the target is below $?p138347[{$138347s1=45}][35]% health, this effect will deal {$114867s1=0} additional Shadowfrost damage. If the enemy dies before this effect triggers, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.27
 

Action details: soul_reaper_execute

Static Values
  • id:114867
  • school:shadowfrost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{[email protected]=Strikes an enemy for $sw1 Physical damage, afflicts the target with Soul Reaper, and increases the healing from your next Death Strike by {$50421s1=20}%. After {$d=5 seconds}, if the target is below $?p138347[{$138347s1=45}][35]% health, this effect will deal {$114867s1=0} additional Shadowfrost damage. If the enemy dies before this effect triggers, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.}
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
pet - army_of_the_dead 3483 / 275
auto_attack_mh 2160 0.1% 295.8 0.92sec 256 275 Direct 295.8 190 380 214 12.5% 0.0% 194.0 57 114 12.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 295.77 295.77 0.00 0.00 0.9309 0.0000 75583.84 116160.42 34.93 274.53 274.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.34 12.55% 113.84 70 141 113.85 91 138 2771 4258 34.93
multistrike 169.66 87.45% 56.94 35 71 56.94 50 63 9661 14848 34.93
hit 258.83 87.51% 189.80 117 236 189.80 170 210 49127 75500 34.93
crit 36.93 12.49% 379.73 235 471 379.76 314 448 14025 21554 34.93
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Claw 1323 0.1% 143.8 2.20sec 322 0 Direct 143.8 239 478 269 12.5% 0.0% 94.3 72 144 12.5%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 143.77 143.77 0.00 0.00 0.0000 0.0000 46308.59 71169.00 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.75 12.46% 143.50 88 177 143.55 88 177 1686 2591 34.93
multistrike 82.52 87.54% 71.80 44 88 71.80 62 81 5925 9106 34.93
hit 125.81 87.51% 239.32 147 295 239.32 215 264 30109 46274 34.93
crit 17.95 12.49% 478.41 293 589 478.37 360 569 8588 13199 34.93
 
 

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=1}% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.25
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Death_Knight_Frost_1h_T18H 0
Simple Action Stats Execute Interval
Death_Knight_Frost_1h_T18H
Anti-Magic Shell 8.0 60.42sec

Stats details: antimagic_shell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.97 7.97 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: antimagic_shell

Static Values
  • id:48707
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Death_Knight_Frost_1h_T18H
  • harmful:false
  • if_expr:((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
Spelldata
  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to $w1 magic damage. Immune to magic debuffs.
  • description:Surrounds the Death Knight in an Anti-Magic Shell for {$d=5 seconds}, absorbing {$s1=100}% of all magical damage and preventing application of harmful magical effects. {$?s159415=false}[][Damage absorbed generates Runic Power.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Arcane Torrent 5.5 90.46sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 5.49 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:50613
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore ${$m2/10} Runic Power. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Army of the Dead 1.0 0.00sec

Stats details: army_of_the_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 14.00 14.00 0.0000 0.2596 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.87 87.42% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.13 12.58% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: army_of_the_dead

Static Values
  • id:42650
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning Ghouls.
  • description:Summons a legion of Ghouls over {$d=4 seconds} who will fight for the Death Knight for {$42651d=40 seconds}, swarming the area, taunting and fighting anything they can.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:30.00
 
Blood Tap 50.4 8.76sec

Stats details: blood_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.39 50.39 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.10 87.53% 0.00 0 0 0.00 0 0 0 0 0.00
crit 6.29 12.47% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:(target.health.pct-3*(target.health.pct%target.time_to_die)<=35&cooldown.soul_reaper.remains=0)
Spelldata
  • id:45529
  • name:Blood Tap
  • school:physical
  • tooltip:
  • description:Every {$s1=15} Runic Power you spend will generate a Blood Charge. Max {$114851u=12} charges. Blood Tap consumes {$114851s1=5} Blood Charges to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Draenic Strength Potion (potion) 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156428
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your Strength by {$s1=1000} for {$d=25 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Empower Rune Weapon 1.8 307.67sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.82 1.82 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.59 87.43% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.23 12.57% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
 
frost_presence 1.0 0.00sec

Stats details: frost_presence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.88 87.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.12 12.43% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: frost_presence

Static Values
  • id:48266
  • school:none
  • resource:runic_power
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Horn of Winter 1.0 0.00sec

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.88 87.73% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.12 12.27% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by {$s1=10}%.
  • description:The Death Knight blows the Horn of Winter, increasing attack power of all party and raid members within $a1 yards by {$s1=10}% for {$d=3600 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Pillar of Frost 8.0 60.42sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.97 7.97 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.97 87.49% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.00 12.51% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Movement speed reduced by {$90259s2=70}%.][ Immune to movement from external sources.]
  • description:The power of Frost increases the Death Knight's Strength by {$s1=15}%, and grants immunity to external movement effects such as knockbacks{$?s58635=false}[, and immunity to all effects that cause loss of control, but also reducing movement speed by {$90259s2=70}% while active][]. Lasts {$d=20 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Plague Leech 14.4 29.58sec

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.36 14.36 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:disease.min_remains<1
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:
  • description:Consumes your Blood Plague and Frost Fever on the target to activate up to {$s1=2} random fully-depleted runes as Death Runes.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Unholy Strength 36.7 12.41sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 36.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Death_Knight_Frost_1h_T18H
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=3}% and increase total Strength by {$53365s1=20}% for {$53365d=15 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Archmage's Greater Incandescence (_str) 8.6 0.0 53.5sec 53.1sec 18.81% 18.83% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_archmages_greater_incandescence_str
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • archmages_greater_incandescence_str_1:18.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177175
  • name:Archmage's Greater Incandescence
  • tooltip:Increases Strength by 15% for {$d=10 seconds}.
  • description:Increases Strength by 15% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Charge 32.5 121.2 13.7sec 2.9sec 87.40% 87.40% 0.6(0.7)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_blood_charge
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blood_charge_1:18.15%
  • blood_charge_2:6.62%
  • blood_charge_3:23.62%
  • blood_charge_4:6.15%
  • blood_charge_5:19.23%
  • blood_charge_6:6.38%
  • blood_charge_7:1.64%
  • blood_charge_8:2.81%
  • blood_charge_9:0.51%
  • blood_charge_10:1.44%
  • blood_charge_11:0.54%
  • blood_charge_12:0.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114851
  • name:Blood Charge
  • tooltip:Stored blood energy. Blood Tap consumes 5 Blood Charges to activate a random fully-depleted rune as a Death Rune.
  • description:{[email protected]=Every {$s1=15} Runic Power you spend will generate a Blood Charge. Max {$114851u=12} charges. Blood Tap consumes {$114851s1=5} Blood Charges to activate a random fully-depleted rune as a Death Rune.}
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 18.34% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Draenic Strength Potion 2.0 0.0 406.2sec 0.0sec 10.82% 10.84% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:10.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your Strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Frozen Wake 2.7 125.9 147.2sec 3.5sec 98.24% 98.04% 125.9(125.9)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_frozen_wake
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frozen_wake_1:98.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187894
  • name:Frozen Wake
  • tooltip:Critical damage increased by $w1%.
  • description:{[email protected]=When you critically hit with Obliterate you gain $187893m1% haste for {$187893d=12 seconds}. When you critically hit with Frost Strike, your critical damage is increased by $187894m1% for {$187894d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Killing Machine 50.1 74.1 9.0sec 3.6sec 63.93% 79.50% 74.1(74.1)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:63.93%

Trigger Attempt Success

  • trigger_pct:26.01%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to cause your next Obliterate or Frost Strike to be a guaranteed critical strike.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Obliteration 11.1 3.0 40.2sec 31.0sec 34.48% 42.06% 3.0(3.0)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_obliteration
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • obliteration_1:34.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187893
  • name:Obliteration
  • tooltip:Melee haste increased by $w1%.
  • description:{[email protected]=When you critically hit with Obliterate you gain $187893m1% haste for {$187893d=12 seconds}. When you critically hit with Frost Strike, your critical damage is increased by $187894m1% for {$187894d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Pillar of Frost 8.0 0.0 60.4sec 60.4sec 34.59% 37.78% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:34.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Movement speed reduced by {$90259s2=70}%.][ Immune to movement from external sources.]
  • description:The power of Frost increases the Death Knight's Strength by {$s1=15}%, and grants immunity to external movement effects such as knockbacks{$?s58635=false}[, and immunity to all effects that cause loss of control, but also reducing movement speed by {$90259s2=70}% while active][]. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Freezing Fog (rime) 9.1 0.0 46.6sec 46.6sec 3.72% 3.75% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 13.0 23.7 35.8sec 12.4sec 75.11% 73.63% 23.7(23.7)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:75.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=20}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=3}% and increase total Strength by {$53365s1=20}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
buttered_sturgeon_food

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_buttered_sturgeon_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:125.00

Stack Uptimes

  • buttered_sturgeon_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Presence

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by {$s5=20}%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by {$s1=20}%, {$?s50385=false}[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by {$s5=20}%. Activating a new Presence will cancel this one and consume {$?s58647=false}[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Strength Flask

Buff details

  • buff initial source:Death_Knight_Frost_1h_T18H
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_1h_T18H
frost_strike Runic Power 153.7 3841.5 25.0 25.0 2255.8
pet - army_of_the_dead
claw Energy 143.8 5750.7 40.0 40.0 8.1
Resource Gains Type Count Total Average Overflow
rp_army_of_the_dead Runic Power 1.00 30.00 (0.77%) 30.00 0.00 0.00%
rp_empower_rune_weapon Runic Power 1.82 45.58 (1.18%) 24.99 0.02 0.05%
rp_soul_reaper Runic Power 24.35 242.28 (6.26%) 9.95 1.21 0.50%
rp_howling_blast Runic Power 153.35 1504.73 (38.85%) 9.81 28.78 1.88%
rp_plague_strike Runic Power 31.93 319.27 (8.24%) 10.00 0.00 0.00%
rp_obliterate Runic Power 20.21 403.04 (10.41%) 19.95 1.06 0.26%
rp_blood_boil Runic Power 13.00 129.57 (3.35%) 9.96 0.46 0.36%
rp_defile Runic Power 14.91 137.23 (3.54%) 9.21 11.83 7.94%
arcane_torrent Runic Power 5.49 105.91 (2.73%) 19.30 3.83 3.49%
antimagic_shell Runic Power 7.97 392.00 (10.12%) 49.21 6.26 1.57%
frost_presence Runic Power 260.56 563.25 (14.54%) 2.16 7.76 1.36%
rune_regen_all None 3743.94 191.73 (50.00%) 0.05 7.51 3.77%
rune_regen_unholy None 1242.91 62.16 (16.21%) 0.05 3.86 5.85%
rune_regen_blood None 1249.49 63.34 (16.52%) 0.05 3.20 4.81%
rune_regen_frost None 1251.54 66.22 (17.27%) 0.05 0.45 0.67%
empower_rune_weapon Rune 1.82 6.81 (5.00%) 3.73 4.14 37.79%
blood_tap Rune 50.39 50.39 (36.99%) 1.00 0.00 0.00%
blood_tap_blood Rune 16.56 16.56 (12.15%) 1.00 0.00 0.00%
blood_tap_frost Rune 16.66 16.66 (12.23%) 1.00 0.00 0.00%
blood_tap_unholy Rune 17.18 17.18 (12.61%) 1.00 0.00 0.00%
plague_leech Rune 28.65 28.65 (21.03%) 1.00 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 66.56 621.67 (100.00%) 9.34 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 8.60 8.54
Combat End Resource Mean Min Max
Runic Power 26.28 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 1.1%

Procs

Count Interval
Army of the Dead: Frost 1.0 0.0sec
Army of the Dead: Unholy 1.0 0.0sec
Army of the Dead: Death 1.0 0.0sec
Soul Reaper: Frost 7.1 17.5sec
Soul Reaper: Death 17.2 9.1sec
Howling Blast: Frost 52.3 8.6sec
Howling Blast: Death 101.1 4.4sec
Plague Strike: Unholy 31.9 13.4sec
Obliterate: Frost 9.5 45.5sec
Obliterate: Unholy 20.2 22.0sec
Obliterate: Death 10.7 40.4sec
Blood Boil: Death 13.0 33.6sec
Defile: Unholy 12.0 38.7sec
Defile: Death 2.9 88.2sec
oblit_killing_machine 13.2 33.0sec
frost_strike_killing_machine 125.0 3.6sec
Blood runes ready 93.4 4.9sec
Frost runes ready 96.4 4.8sec
Unholy runes ready 86.3 5.3sec
Killing Machine expired naturally 1.3 115.4sec

Statistics & Data Analysis

Fight Length
Sample Data Death_Knight_Frost_1h_T18H Fight Length
Count 7499
Mean 450.52
Minimum 350.62
Maximum 556.81
Spread ( max - min ) 206.19
Range [ ( max - min ) / 2 * 100% ] 22.88%
DPS
Sample Data Death_Knight_Frost_1h_T18H Damage Per Second
Count 7499
Mean 116172.80
Minimum 109128.82
Maximum 123984.51
Spread ( max - min ) 14855.69
Range [ ( max - min ) / 2 * 100% ] 6.39%
Standard Deviation 1941.6334
5th Percentile 113059.64
95th Percentile 119337.11
( 95th Percentile - 5th Percentile ) 6277.47
Mean Distribution
Standard Deviation 22.4215
95.00% Confidence Intervall ( 116128.85 - 116216.74 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1073
0.1 Scale Factor Error with Delta=300 32182
0.05 Scale Factor Error with Delta=300 128729
0.01 Scale Factor Error with Delta=300 3218237
Priority Target DPS
Sample Data Death_Knight_Frost_1h_T18H Priority Target Damage Per Second
Count 7499
Mean 64621.76
Minimum 60007.59
Maximum 70107.81
Spread ( max - min ) 10100.22
Range [ ( max - min ) / 2 * 100% ] 7.81%
Standard Deviation 1289.9045
5th Percentile 62514.09
95th Percentile 66789.75
( 95th Percentile - 5th Percentile ) 4275.66
Mean Distribution
Standard Deviation 14.8955
95.00% Confidence Intervall ( 64592.57 - 64650.96 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1530
0.1 Scale Factor Error with Delta=300 14203
0.05 Scale Factor Error with Delta=300 56814
0.01 Scale Factor Error with Delta=300 1420361
DPS(e)
Sample Data Death_Knight_Frost_1h_T18H Damage Per Second (Effective)
Count 7499
Mean 116172.80
Minimum 109128.82
Maximum 123984.51
Spread ( max - min ) 14855.69
Range [ ( max - min ) / 2 * 100% ] 6.39%
Damage
Sample Data Death_Knight_Frost_1h_T18H Damage
Count 7499
Mean 52182697.97
Minimum 39848883.04
Maximum 65308798.61
Spread ( max - min ) 25459915.57
Range [ ( max - min ) / 2 * 100% ] 24.39%
DTPS
Sample Data Death_Knight_Frost_1h_T18H Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Death_Knight_Frost_1h_T18H Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Death_Knight_Frost_1h_T18H Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Death_Knight_Frost_1h_T18H Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Death_Knight_Frost_1h_T18H Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Death_Knight_Frost_1h_T18H Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Death_Knight_Frost_1h_T18HTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Death_Knight_Frost_1h_T18H Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=buttered_sturgeon
2 0.00 horn_of_winter
3 0.00 frost_presence
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 army_of_the_dead
6 0.00 potion,name=draenic_strength
7 0.00 pillar_of_frost
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_attack
0.00 deaths_advance,if=movement.remains>2
9 7.97 antimagic_shell,damage=100000,if=((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
A 6.97 pillar_of_frost
B 1.00 potion,name=draenic_strength,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
C 0.37 empower_rune_weapon,if=target.time_to_die<=60&buff.potion.up
0.00 blood_fury
0.00 berserking
D 5.49 arcane_torrent
E 0.23 plague_leech,if=disease.min_remains<1
F 24.35 soul_reaper,if=target.health.pct-3*(target.health.pct%target.time_to_die)<=35
G 6.58 blood_tap,if=(target.health.pct-3*(target.health.pct%target.time_to_die)<=35&cooldown.soul_reaper.remains=0)
H 0.00 run_action_list,name=single_target_2h,if=spell_targets.howling_blast<4&main_hand.2h
I 0.00 run_action_list,name=single_target_1h,if=spell_targets.howling_blast<3&main_hand.1h
J 0.00 run_action_list,name=multi_target,if=spell_targets.howling_blast>=3+main_hand.2h
actions.multi_target
# count action,conditions
0.00 unholy_blight
K 118.51 frost_strike,if=buff.killing_machine.react&main_hand.1h
L 20.20 obliterate,if=unholy>1
M 13.00 blood_boil,if=dot.blood_plague.ticking&(!talent.unholy_blight.enabled|cooldown.unholy_blight.remains<49),line_cd=28
N 14.91 defile
0.00 breath_of_sindragosa,if=runic_power>75
O 0.00 run_action_list,name=multi_target_bos,if=dot.breath_of_sindragosa.ticking
P 162.37 howling_blast
Q 1.21 blood_tap,if=buff.blood_charge.stack>10
R 1.84 frost_strike,if=runic_power>88
0.00 death_and_decay,if=unholy=1
S 4.63 plague_strike,if=unholy=2&!dot.blood_plague.ticking&!talent.necrotic_plague.enabled
T 42.59 blood_tap
U 33.31 frost_strike,if=!talent.breath_of_sindragosa.enabled|cooldown.breath_of_sindragosa.remains>=10
V 14.13 plague_leech
W 27.30 plague_strike,if=unholy=1
X 1.46 empower_rune_weapon
actions.single_target_1h
# count action,conditions
0.00 breath_of_sindragosa,if=runic_power>75
Y 0.00 run_action_list,name=single_target_bos,if=dot.breath_of_sindragosa.ticking
Z 0.00 frost_strike,if=buff.killing_machine.react
a 0.00 obliterate,if=unholy>1|buff.killing_machine.react
0.00 defile
0.00 blood_tap,if=talent.defile.enabled&cooldown.defile.remains=0
0.00 frost_strike,if=runic_power>88
b 0.00 howling_blast,if=buff.rime.react|death>1|frost>1
0.00 blood_tap,if=buff.blood_charge.stack>10
0.00 frost_strike,if=runic_power>76
0.00 unholy_blight,if=!disease.ticking
c 0.00 outbreak,if=!dot.blood_plague.ticking
0.00 plague_strike,if=!talent.necrotic_plague.enabled&!dot.blood_plague.ticking
d 0.00 howling_blast,if=!(target.health.pct-3*(target.health.pct%target.time_to_die)<=35&cooldown.soul_reaper.remains<3)|death+frost>=2
0.00 outbreak,if=talent.necrotic_plague.enabled&debuff.necrotic_plague.stack<=14
0.00 blood_tap
0.00 plague_leech
0.00 empower_rune_weapon

Sample Sequence

012356789DNPPKKKPPLPPTPRULPPUTPPLKKKKPLKPPNKPTPKPPKSTMKPPKTPVLKPKPPKTPLKPWPU9APTNUUPKTPKLKVPPKPPKSTMKPPUTPWUPPKWDUTNWPUPKVPLKPPKTPKXKLKPPPKPTPLUTPKP9AUNPKTPPUUPKSKTMPKPVPKLPTPKPUWPKPTPUNPUPWKTPMKPVPKPWKPPTPKWKPPKTP9ADKKKLNKPPKTMPKPTPUVPLKPKPTPKPLKPWPPKNKTPPMUVPKPPKLPTPUWKPPKTPWKP9AKKPKNTPKMPKTPVPPKLPPUTPKPPKSWKPPKDKTPWKPMTNKVPPKPPKSTPKPPUWWKGFPKPW9AKKFKMTPKNUFPTPUVLFPKPKPGFUPPKWWKFPKTMWKFNUTPVPFKLKPKGFPKPWUFPDU9ATPUUUGFMPUNUVFPKPPKGFSKPWPUGFWKPPUFWUMTPKVFLKNPCKFKLPKKFTPKPSKFTPBK9APKTPFKKTLPKKFVNKPPFKPKSTMFKPTPU

Sample Sequence Table

time name target resources buffs
Pre flask fluffy_pillow 0.0/100: 0% runic_power
Pre food fluffy_pillow 0.0/100: 0% runic_power
Pre horn_of_winter fluffy_pillow 0.0/100: 0% runic_power
Pre frost_presence fluffy_pillow 0.0/100: 0% runic_power
Pre army_of_the_dead fluffy_pillow 31.0/100: 31% runic_power
Pre potion fluffy_pillow 31.0/100: 31% runic_power draenic_strength_potion
Pre pillar_of_frost fluffy_pillow 31.0/100: 31% runic_power pillar_of_frost, draenic_strength_potion
0:00.000 auto_attack fluffy_pillow 31.0/100: 31% runic_power pillar_of_frost, draenic_strength_potion
0:00.000 antimagic_shell Death_Knight_Frost_1h_T18H 31.0/100: 31% runic_power pillar_of_frost, unholy_strength, draenic_strength_potion
0:00.000 arcane_torrent fluffy_pillow 81.0/100: 81% runic_power pillar_of_frost, unholy_strength, draenic_strength_potion
0:00.000 defile fluffy_pillow 100.0/100: 100% runic_power pillar_of_frost, unholy_strength, draenic_strength_potion
0:01.004 howling_blast fluffy_pillow 100.0/100: 100% runic_power bloodlust, archmages_greater_incandescence_str, pillar_of_frost, unholy_strength, draenic_strength_potion
0:02.010 howling_blast fluffy_pillow 100.0/100: 100% runic_power bloodlust, archmages_greater_incandescence_str, pillar_of_frost, unholy_strength, draenic_strength_potion
0:03.016 frost_strike fluffy_pillow 100.0/100: 100% runic_power bloodlust, archmages_greater_incandescence_str, killing_machine, pillar_of_frost, unholy_strength, draenic_strength_potion
0:04.023 frost_strike fluffy_pillow 75.0/100: 75% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:05.028 frost_strike fluffy_pillow 50.0/100: 50% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:06.033 howling_blast fluffy_pillow 25.0/100: 25% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:07.040 howling_blast fluffy_pillow 37.0/100: 37% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:08.043 obliterate fluffy_pillow 49.0/100: 49% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:09.048 howling_blast fluffy_pillow 73.0/100: 73% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(5), pillar_of_frost, rime, unholy_strength, frozen_wake, draenic_strength_potion
0:10.053 howling_blast fluffy_pillow 73.0/100: 73% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:11.059 blood_tap fluffy_pillow 85.0/100: 85% runic_power bloodlust, blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:11.059 howling_blast fluffy_pillow 85.0/100: 85% runic_power bloodlust, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:12.063 frost_strike fluffy_pillow 97.0/100: 97% runic_power bloodlust, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:13.068 frost_strike fluffy_pillow 72.0/100: 72% runic_power bloodlust, blood_charge, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:14.075 obliterate fluffy_pillow 47.0/100: 47% runic_power bloodlust, blood_charge(3), pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:15.079 howling_blast fluffy_pillow 71.0/100: 71% runic_power bloodlust, blood_charge(3), pillar_of_frost, rime, unholy_strength, frozen_wake, draenic_strength_potion
0:16.085 howling_blast fluffy_pillow 71.0/100: 71% runic_power bloodlust, blood_charge(3), pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
0:17.091 frost_strike fluffy_pillow 83.0/100: 83% runic_power bloodlust, blood_charge(3), pillar_of_frost, unholy_strength, draenic_strength_potion
0:18.096 blood_tap fluffy_pillow 58.0/100: 58% runic_power bloodlust, blood_charge(5), pillar_of_frost, unholy_strength, draenic_strength_potion
0:18.096 howling_blast fluffy_pillow 58.0/100: 58% runic_power bloodlust, pillar_of_frost, unholy_strength, draenic_strength_potion
0:19.101 howling_blast fluffy_pillow 70.0/100: 70% runic_power bloodlust, pillar_of_frost, unholy_strength, draenic_strength_potion
0:20.106 obliterate fluffy_pillow 82.0/100: 82% runic_power bloodlust, unholy_strength, draenic_strength_potion
0:21.112 frost_strike fluffy_pillow 100.0/100: 100% runic_power bloodlust, killing_machine, unholy_strength, draenic_strength_potion
0:22.118 frost_strike fluffy_pillow 75.0/100: 75% runic_power bloodlust, blood_charge, killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
0:23.123 frost_strike fluffy_pillow 50.0/100: 50% runic_power bloodlust, blood_charge(3), killing_machine, unholy_strength, frozen_wake
0:24.128 frost_strike fluffy_pillow 25.0/100: 25% runic_power bloodlust, blood_charge(5), killing_machine, frozen_wake
0:25.134 howling_blast fluffy_pillow 0.0/100: 0% runic_power bloodlust, blood_charge(6), killing_machine, frozen_wake
0:26.137 obliterate fluffy_pillow 12.0/100: 12% runic_power bloodlust, blood_charge(6), killing_machine, frozen_wake
0:27.141 frost_strike fluffy_pillow 36.0/100: 36% runic_power bloodlust, blood_charge(6), killing_machine, rime, obliteration, frozen_wake
0:28.144 howling_blast fluffy_pillow 11.0/100: 11% runic_power bloodlust, blood_charge(8), killing_machine, rime, obliteration, frozen_wake
0:29.149 howling_blast fluffy_pillow 11.0/100: 11% runic_power bloodlust, blood_charge(8), killing_machine, obliteration, frozen_wake
0:30.153 defile fluffy_pillow 23.0/100: 23% runic_power bloodlust, blood_charge(8), killing_machine, obliteration, frozen_wake
0:31.156 frost_strike fluffy_pillow 35.0/100: 35% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(8), killing_machine, obliteration, frozen_wake
0:32.162 howling_blast fluffy_pillow 10.0/100: 10% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(10), obliteration, frozen_wake
0:33.167 blood_tap fluffy_pillow 22.0/100: 22% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(10), unholy_strength, obliteration, frozen_wake
0:33.167 howling_blast fluffy_pillow 22.0/100: 22% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(5), unholy_strength, obliteration, frozen_wake
0:34.171 frost_strike fluffy_pillow 34.0/100: 34% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
0:35.177 howling_blast fluffy_pillow 9.0/100: 9% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(6), killing_machine, unholy_strength, obliteration, frozen_wake
0:36.182 howling_blast fluffy_pillow 21.0/100: 21% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(6), killing_machine, unholy_strength, obliteration, frozen_wake
0:37.187 frost_strike fluffy_pillow 33.0/100: 33% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(6), killing_machine, unholy_strength, obliteration, frozen_wake
0:38.191 plague_strike fluffy_pillow 8.0/100: 8% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(8), killing_machine, unholy_strength, frozen_wake
0:39.197 blood_tap fluffy_pillow 20.0/100: 20% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(8), killing_machine, unholy_strength, frozen_wake
0:39.197 blood_boil fluffy_pillow 20.0/100: 20% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
0:40.202 frost_strike fluffy_pillow 32.0/100: 32% runic_power bloodlust, archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
0:41.207 howling_blast fluffy_pillow 7.0/100: 7% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
0:42.213 howling_blast fluffy_pillow 19.0/100: 19% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
0:43.218 frost_strike fluffy_pillow 31.0/100: 31% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
0:44.223 blood_tap fluffy_pillow 6.0/100: 6% runic_power blood_charge(6), killing_machine, unholy_strength, frozen_wake
0:44.223 howling_blast fluffy_pillow 6.0/100: 6% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
0:45.227 plague_leech fluffy_pillow 18.0/100: 18% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
0:46.233 obliterate fluffy_pillow 18.0/100: 18% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
0:47.238 frost_strike fluffy_pillow 42.0/100: 42% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
0:48.242 howling_blast fluffy_pillow 17.0/100: 17% runic_power blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
0:49.248 frost_strike fluffy_pillow 29.0/100: 29% runic_power blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
0:50.253 howling_blast fluffy_pillow 4.0/100: 4% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
0:51.257 howling_blast fluffy_pillow 16.0/100: 16% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
0:52.261 frost_strike fluffy_pillow 28.0/100: 28% runic_power blood_charge(5), killing_machine, obliteration, frozen_wake
0:53.266 blood_tap fluffy_pillow 3.0/100: 3% runic_power blood_charge(6), killing_machine, obliteration, frozen_wake
0:53.266 howling_blast fluffy_pillow 3.0/100: 3% runic_power blood_charge, killing_machine, obliteration, frozen_wake
0:54.270 obliterate fluffy_pillow 15.0/100: 15% runic_power blood_charge, killing_machine, obliteration, frozen_wake
0:55.274 frost_strike fluffy_pillow 39.0/100: 39% runic_power blood_charge, killing_machine, rime, obliteration, frozen_wake
0:56.278 howling_blast fluffy_pillow 14.0/100: 14% runic_power blood_charge(3), rime, obliteration, frozen_wake
0:57.280 plague_strike fluffy_pillow 14.0/100: 14% runic_power blood_charge(3), obliteration, frozen_wake
0:58.284 howling_blast fluffy_pillow 26.0/100: 26% runic_power blood_charge(3), obliteration, frozen_wake
0:59.287 frost_strike fluffy_pillow 38.0/100: 38% runic_power blood_charge(3), obliteration, frozen_wake
1:00.290 antimagic_shell Death_Knight_Frost_1h_T18H 13.0/100: 13% runic_power blood_charge(5), obliteration, frozen_wake
1:00.290 pillar_of_frost fluffy_pillow 63.0/100: 63% runic_power blood_charge(5), obliteration, frozen_wake
1:00.290 howling_blast fluffy_pillow 63.0/100: 63% runic_power blood_charge(5), pillar_of_frost, obliteration, frozen_wake
1:01.295 blood_tap fluffy_pillow 75.0/100: 75% runic_power blood_charge(5), pillar_of_frost, obliteration, frozen_wake
1:01.295 defile fluffy_pillow 75.0/100: 75% runic_power pillar_of_frost, obliteration, frozen_wake
1:02.299 frost_strike fluffy_pillow 87.0/100: 87% runic_power killing_machine, pillar_of_frost, obliteration, frozen_wake
1:03.304 frost_strike fluffy_pillow 62.0/100: 62% runic_power blood_charge, pillar_of_frost, obliteration, frozen_wake
1:04.309 howling_blast fluffy_pillow 37.0/100: 37% runic_power blood_charge(3), killing_machine, pillar_of_frost, obliteration, frozen_wake
1:05.313 frost_strike fluffy_pillow 49.0/100: 49% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:06.317 blood_tap fluffy_pillow 24.0/100: 24% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
1:06.317 howling_blast fluffy_pillow 24.0/100: 24% runic_power killing_machine, pillar_of_frost, unholy_strength, frozen_wake
1:07.321 frost_strike fluffy_pillow 36.0/100: 36% runic_power killing_machine, pillar_of_frost, unholy_strength, frozen_wake
1:08.326 obliterate fluffy_pillow 11.0/100: 11% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
1:09.331 frost_strike fluffy_pillow 35.0/100: 35% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:10.334 plague_leech fluffy_pillow 10.0/100: 10% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:11.339 howling_blast fluffy_pillow 10.0/100: 10% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:12.342 howling_blast fluffy_pillow 22.0/100: 22% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:13.346 frost_strike fluffy_pillow 34.0/100: 34% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:14.351 howling_blast fluffy_pillow 9.0/100: 9% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:15.355 howling_blast fluffy_pillow 21.0/100: 21% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:16.358 frost_strike fluffy_pillow 33.0/100: 33% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:17.363 plague_strike fluffy_pillow 8.0/100: 8% runic_power blood_charge(6), pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:18.367 blood_tap fluffy_pillow 20.0/100: 20% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:18.367 blood_boil fluffy_pillow 20.0/100: 20% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:19.372 frost_strike fluffy_pillow 32.0/100: 32% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
1:20.377 howling_blast fluffy_pillow 7.0/100: 7% runic_power blood_charge(3), unholy_strength, frozen_wake
1:21.381 howling_blast fluffy_pillow 19.0/100: 19% runic_power blood_charge(3), unholy_strength, frozen_wake
1:22.386 frost_strike fluffy_pillow 31.0/100: 31% runic_power blood_charge(3), unholy_strength, frozen_wake
1:23.390 blood_tap fluffy_pillow 6.0/100: 6% runic_power blood_charge(5), unholy_strength, frozen_wake
1:23.390 howling_blast fluffy_pillow 6.0/100: 6% runic_power unholy_strength, frozen_wake
1:24.395 plague_strike fluffy_pillow 18.0/100: 18% runic_power unholy_strength, frozen_wake
1:25.400 frost_strike fluffy_pillow 30.0/100: 30% runic_power unholy_strength, frozen_wake
1:26.403 howling_blast fluffy_pillow 5.0/100: 5% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
1:27.409 howling_blast fluffy_pillow 17.0/100: 17% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
1:28.415 frost_strike fluffy_pillow 29.0/100: 29% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
1:29.418 plague_strike fluffy_pillow 4.0/100: 4% runic_power blood_charge(3), unholy_strength, frozen_wake
1:30.421 arcane_torrent fluffy_pillow 16.0/100: 16% runic_power blood_charge(3), unholy_strength, frozen_wake
1:30.421 frost_strike fluffy_pillow 36.0/100: 36% runic_power blood_charge(3), unholy_strength, frozen_wake
1:31.425 blood_tap fluffy_pillow 11.0/100: 11% runic_power blood_charge(5), unholy_strength, frozen_wake
1:31.425 defile fluffy_pillow 11.0/100: 11% runic_power unholy_strength, frozen_wake
1:32.431 plague_strike fluffy_pillow 23.0/100: 23% runic_power unholy_strength, frozen_wake
1:33.436 howling_blast fluffy_pillow 35.0/100: 35% runic_power unholy_strength, frozen_wake
1:34.439 frost_strike fluffy_pillow 47.0/100: 47% runic_power unholy_strength, frozen_wake
1:35.444 howling_blast fluffy_pillow 22.0/100: 22% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
1:36.448 frost_strike fluffy_pillow 34.0/100: 34% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
1:37.452 plague_leech fluffy_pillow 9.0/100: 9% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
1:38.456 howling_blast fluffy_pillow 9.0/100: 9% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
1:39.460 obliterate fluffy_pillow 21.0/100: 21% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
1:40.463 frost_strike fluffy_pillow 45.0/100: 45% runic_power blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
1:41.467 howling_blast fluffy_pillow 20.0/100: 20% runic_power blood_charge(5), unholy_strength, obliteration, frozen_wake
1:42.472 howling_blast fluffy_pillow 32.0/100: 32% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
1:43.477 frost_strike fluffy_pillow 44.0/100: 44% runic_power blood_charge(5), killing_machine, obliteration, frozen_wake
1:44.481 blood_tap fluffy_pillow 19.0/100: 19% runic_power blood_charge(6), killing_machine, obliteration, frozen_wake
1:44.481 howling_blast fluffy_pillow 19.0/100: 19% runic_power blood_charge, killing_machine, obliteration, frozen_wake
1:45.485 frost_strike fluffy_pillow 31.0/100: 31% runic_power blood_charge, killing_machine, obliteration, frozen_wake
1:46.492 empower_rune_weapon fluffy_pillow 6.0/100: 6% runic_power blood_charge(3), killing_machine, obliteration, frozen_wake
1:46.492 frost_strike fluffy_pillow 36.0/100: 36% runic_power blood_charge(3), killing_machine, obliteration, frozen_wake
1:47.496 obliterate fluffy_pillow 11.0/100: 11% runic_power blood_charge(5), killing_machine, obliteration, frozen_wake
1:48.502 frost_strike fluffy_pillow 35.0/100: 35% runic_power blood_charge(5), killing_machine, rime, obliteration, frozen_wake
1:49.506 howling_blast fluffy_pillow 10.0/100: 10% runic_power blood_charge(6), killing_machine, rime, obliteration, frozen_wake
1:50.510 howling_blast fluffy_pillow 10.0/100: 10% runic_power blood_charge(6), killing_machine, obliteration, frozen_wake
1:51.512 howling_blast fluffy_pillow 22.0/100: 22% runic_power blood_charge(6), killing_machine, obliteration, frozen_wake
1:52.516 frost_strike fluffy_pillow 34.0/100: 34% runic_power blood_charge(6), killing_machine, obliteration, frozen_wake
1:53.522 howling_blast fluffy_pillow 9.0/100: 9% runic_power blood_charge(8), obliteration, frozen_wake
1:54.528 blood_tap fluffy_pillow 21.0/100: 21% runic_power blood_charge(8), obliteration, frozen_wake
1:54.528 howling_blast fluffy_pillow 21.0/100: 21% runic_power blood_charge(3), obliteration, frozen_wake
1:55.533 obliterate fluffy_pillow 33.0/100: 33% runic_power blood_charge(3), obliteration, frozen_wake
1:56.537 frost_strike fluffy_pillow 57.0/100: 57% runic_power blood_charge(3), unholy_strength, obliteration, frozen_wake
1:57.542 blood_tap fluffy_pillow 32.0/100: 32% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
1:57.542 howling_blast fluffy_pillow 32.0/100: 32% runic_power killing_machine, unholy_strength, obliteration, frozen_wake
1:58.546 frost_strike fluffy_pillow 44.0/100: 44% runic_power killing_machine, unholy_strength, obliteration, frozen_wake
1:59.550 howling_blast fluffy_pillow 19.0/100: 19% runic_power blood_charge, unholy_strength, frozen_wake
2:00.553 antimagic_shell Death_Knight_Frost_1h_T18H 31.0/100: 31% runic_power blood_charge, unholy_strength, frozen_wake
2:00.553 pillar_of_frost fluffy_pillow 81.0/100: 81% runic_power blood_charge, unholy_strength, frozen_wake
2:00.553 frost_strike fluffy_pillow 81.0/100: 81% runic_power blood_charge, pillar_of_frost, unholy_strength, frozen_wake
2:01.559 defile fluffy_pillow 56.0/100: 56% runic_power blood_charge(3), pillar_of_frost, unholy_strength, frozen_wake
2:02.565 howling_blast fluffy_pillow 68.0/100: 68% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
2:03.570 frost_strike fluffy_pillow 80.0/100: 80% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
2:04.576 blood_tap fluffy_pillow 55.0/100: 55% runic_power blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake
2:04.576 howling_blast fluffy_pillow 55.0/100: 55% runic_power pillar_of_frost, unholy_strength, frozen_wake
2:05.579 howling_blast fluffy_pillow 67.0/100: 67% runic_power pillar_of_frost, unholy_strength, frozen_wake
2:06.583 frost_strike fluffy_pillow 79.0/100: 79% runic_power pillar_of_frost, unholy_strength, frozen_wake
2:07.587 frost_strike fluffy_pillow 54.0/100: 54% runic_power blood_charge, pillar_of_frost, unholy_strength, frozen_wake
2:08.592 howling_blast fluffy_pillow 29.0/100: 29% runic_power blood_charge(3), pillar_of_frost, unholy_strength, frozen_wake
2:09.597 frost_strike fluffy_pillow 41.0/100: 41% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
2:10.602 plague_strike fluffy_pillow 16.0/100: 16% runic_power blood_charge(5), killing_machine, pillar_of_frost, frozen_wake
2:11.606 frost_strike fluffy_pillow 28.0/100: 28% runic_power blood_charge(5), killing_machine, pillar_of_frost, frozen_wake
2:12.610 blood_tap fluffy_pillow 3.0/100: 3% runic_power blood_charge(6), killing_machine, pillar_of_frost, frozen_wake
2:12.610 blood_boil fluffy_pillow 3.0/100: 3% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
2:13.615 howling_blast fluffy_pillow 15.0/100: 15% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
2:14.618 frost_strike fluffy_pillow 27.0/100: 27% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
2:15.624 howling_blast fluffy_pillow 2.0/100: 2% runic_power blood_charge(3), killing_machine, pillar_of_frost, frozen_wake
2:16.629 plague_leech fluffy_pillow 14.0/100: 14% runic_power blood_charge(3), killing_machine, pillar_of_frost, frozen_wake
2:17.632 howling_blast fluffy_pillow 14.0/100: 14% runic_power blood_charge(3), killing_machine, pillar_of_frost, frozen_wake
2:18.636 frost_strike fluffy_pillow 26.0/100: 26% runic_power blood_charge(3), killing_machine, pillar_of_frost, frozen_wake
2:19.640 obliterate fluffy_pillow 1.0/100: 1% runic_power blood_charge(5), pillar_of_frost, frozen_wake
2:20.643 howling_blast fluffy_pillow 25.0/100: 25% runic_power blood_charge(5), frozen_wake
2:21.650 blood_tap fluffy_pillow 37.0/100: 37% runic_power blood_charge(5), frozen_wake
2:21.650 howling_blast fluffy_pillow 37.0/100: 37% runic_power frozen_wake
2:22.654 frost_strike fluffy_pillow 49.0/100: 49% runic_power killing_machine, frozen_wake
2:23.657 howling_blast fluffy_pillow 24.0/100: 24% runic_power blood_charge, frozen_wake
2:24.662 frost_strike fluffy_pillow 36.0/100: 36% runic_power blood_charge, frozen_wake
2:25.664 plague_strike fluffy_pillow 11.0/100: 11% runic_power blood_charge(3), frozen_wake
2:26.669 Waiting 0.300 sec 23.0/100: 23% runic_power blood_charge(3), killing_machine, frozen_wake
2:26.969 howling_blast fluffy_pillow 23.0/100: 23% runic_power blood_charge(3), killing_machine, frozen_wake
2:27.975 frost_strike fluffy_pillow 35.0/100: 35% runic_power blood_charge(3), killing_machine, frozen_wake
2:28.979 howling_blast fluffy_pillow 10.0/100: 10% runic_power blood_charge(5), frozen_wake
2:29.984 blood_tap fluffy_pillow 22.0/100: 22% runic_power blood_charge(5), frozen_wake
2:29.984 howling_blast fluffy_pillow 22.0/100: 22% runic_power frozen_wake
2:30.989 frost_strike fluffy_pillow 34.0/100: 34% runic_power killing_machine, frozen_wake
2:31.994 defile fluffy_pillow 9.0/100: 9% runic_power blood_charge, frozen_wake
2:32.998 Waiting 1.200 sec 21.0/100: 21% runic_power blood_charge, frozen_wake
2:34.198 howling_blast fluffy_pillow 21.0/100: 21% runic_power blood_charge, unholy_strength, frozen_wake
2:35.203 frost_strike fluffy_pillow 33.0/100: 33% runic_power blood_charge, unholy_strength, frozen_wake
2:36.207 howling_blast fluffy_pillow 8.0/100: 8% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:37.211 plague_strike fluffy_pillow 20.0/100: 20% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:38.214 frost_strike fluffy_pillow 32.0/100: 32% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:39.217 blood_tap fluffy_pillow 7.0/100: 7% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
2:39.217 howling_blast fluffy_pillow 7.0/100: 7% runic_power killing_machine, unholy_strength, frozen_wake
2:40.222 Waiting 1.300 sec 19.0/100: 19% runic_power killing_machine, unholy_strength, frozen_wake
2:41.522 blood_boil fluffy_pillow 19.0/100: 19% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, frozen_wake
2:42.526 frost_strike fluffy_pillow 31.0/100: 31% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, frozen_wake
2:43.529 howling_blast fluffy_pillow 6.0/100: 6% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, unholy_strength, frozen_wake
2:44.534 plague_leech fluffy_pillow 18.0/100: 18% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, unholy_strength, frozen_wake
2:45.540 howling_blast fluffy_pillow 18.0/100: 18% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, unholy_strength, frozen_wake
2:46.545 frost_strike fluffy_pillow 30.0/100: 30% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, unholy_strength, frozen_wake
2:47.551 howling_blast fluffy_pillow 5.0/100: 5% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:48.557 plague_strike fluffy_pillow 17.0/100: 17% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:49.563 frost_strike fluffy_pillow 29.0/100: 29% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, frozen_wake
2:50.566 howling_blast fluffy_pillow 4.0/100: 4% runic_power archmages_greater_incandescence_str, blood_charge(5), frozen_wake
2:51.570 howling_blast fluffy_pillow 16.0/100: 16% runic_power blood_charge(5), frozen_wake
2:52.576 blood_tap fluffy_pillow 28.0/100: 28% runic_power blood_charge(5), killing_machine, frozen_wake
2:52.576 howling_blast fluffy_pillow 28.0/100: 28% runic_power killing_machine, frozen_wake
2:53.581 frost_strike fluffy_pillow 40.0/100: 40% runic_power killing_machine, frozen_wake
2:54.586 plague_strike fluffy_pillow 15.0/100: 15% runic_power blood_charge, killing_machine, frozen_wake
2:55.591 frost_strike fluffy_pillow 27.0/100: 27% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
2:56.597 howling_blast fluffy_pillow 2.0/100: 2% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:57.602 howling_blast fluffy_pillow 14.0/100: 14% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:58.607 frost_strike fluffy_pillow 26.0/100: 26% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
2:59.612 blood_tap fluffy_pillow 1.0/100: 1% runic_power archmages_greater_incandescence_str, blood_charge(5), killing_machine, unholy_strength, frozen_wake
2:59.612 howling_blast fluffy_pillow 1.0/100: 1% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, frozen_wake
3:00.617 antimagic_shell Death_Knight_Frost_1h_T18H 13.0/100: 13% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, frozen_wake
3:00.617 pillar_of_frost fluffy_pillow 63.0/100: 63% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, frozen_wake
3:00.617 arcane_torrent fluffy_pillow 63.0/100: 63% runic_power archmages_greater_incandescence_str, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
3:00.617 frost_strike fluffy_pillow 83.0/100: 83% runic_power archmages_greater_incandescence_str, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
3:01.623 frost_strike fluffy_pillow 58.0/100: 58% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
3:02.628 frost_strike fluffy_pillow 33.0/100: 33% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
3:03.632 obliterate fluffy_pillow 8.0/100: 8% runic_power archmages_greater_incandescence_str, blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
3:04.637 defile fluffy_pillow 32.0/100: 32% runic_power archmages_greater_incandescence_str, blood_charge(5), killing_machine, pillar_of_frost, rime, unholy_strength, obliteration, frozen_wake
3:05.641 frost_strike fluffy_pillow 44.0/100: 44% runic_power archmages_greater_incandescence_str, blood_charge(5), killing_machine, pillar_of_frost, rime, unholy_strength, obliteration, frozen_wake
3:06.646 howling_blast fluffy_pillow 19.0/100: 19% runic_power blood_charge(6), pillar_of_frost, rime, unholy_strength, obliteration, frozen_wake
3:07.650 howling_blast fluffy_pillow 19.0/100: 19% runic_power blood_charge(6), pillar_of_frost, unholy_strength, obliteration, frozen_wake
3:08.658 frost_strike fluffy_pillow 31.0/100: 31% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
3:09.663 blood_tap fluffy_pillow 6.0/100: 6% runic_power blood_charge(8), killing_machine, pillar_of_frost, obliteration, frozen_wake
3:09.663 blood_boil fluffy_pillow 6.0/100: 6% runic_power blood_charge(3), killing_machine, pillar_of_frost, obliteration, frozen_wake
3:10.667 howling_blast fluffy_pillow 18.0/100: 18% runic_power blood_charge(3), killing_machine, pillar_of_frost, obliteration, frozen_wake
3:11.670 frost_strike fluffy_pillow 30.0/100: 30% runic_power blood_charge(3), killing_machine, pillar_of_frost, obliteration, frozen_wake
3:12.674 howling_blast fluffy_pillow 5.0/100: 5% runic_power blood_charge(5), pillar_of_frost, obliteration, frozen_wake
3:13.677 blood_tap fluffy_pillow 17.0/100: 17% runic_power blood_charge(5), pillar_of_frost, obliteration, frozen_wake
3:13.677 howling_blast fluffy_pillow 17.0/100: 17% runic_power pillar_of_frost, obliteration, frozen_wake
3:14.682 frost_strike fluffy_pillow 29.0/100: 29% runic_power pillar_of_frost, obliteration, frozen_wake
3:15.685 plague_leech fluffy_pillow 4.0/100: 4% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
3:16.689 howling_blast fluffy_pillow 4.0/100: 4% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
3:17.692 obliterate fluffy_pillow 16.0/100: 16% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
3:18.699 frost_strike fluffy_pillow 40.0/100: 40% runic_power blood_charge, killing_machine, pillar_of_frost, obliteration, frozen_wake
3:19.704 howling_blast fluffy_pillow 15.0/100: 15% runic_power blood_charge(3), killing_machine, pillar_of_frost, obliteration, frozen_wake
3:20.708 frost_strike fluffy_pillow 27.0/100: 27% runic_power blood_charge(3), killing_machine, obliteration, frozen_wake
3:21.714 howling_blast fluffy_pillow 2.0/100: 2% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
3:22.716 blood_tap fluffy_pillow 14.0/100: 14% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
3:22.716 howling_blast fluffy_pillow 14.0/100: 14% runic_power killing_machine, unholy_strength, obliteration, frozen_wake
3:23.721 frost_strike fluffy_pillow 26.0/100: 26% runic_power killing_machine, unholy_strength, obliteration, frozen_wake
3:24.728 howling_blast fluffy_pillow 1.0/100: 1% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
3:25.730 obliterate fluffy_pillow 13.0/100: 13% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
3:26.736 frost_strike fluffy_pillow 37.0/100: 37% runic_power blood_charge, killing_machine, rime, unholy_strength, obliteration, frozen_wake
3:27.741 howling_blast fluffy_pillow 12.0/100: 12% runic_power blood_charge(3), rime, unholy_strength, obliteration, frozen_wake
3:28.746 plague_strike fluffy_pillow 12.0/100: 12% runic_power blood_charge(3), unholy_strength, obliteration, frozen_wake
3:29.751 Waiting 2.100 sec 24.0/100: 24% runic_power blood_charge(3), unholy_strength, obliteration, frozen_wake
3:31.851 howling_blast fluffy_pillow 24.0/100: 24% runic_power blood_charge(3), unholy_strength, obliteration, frozen_wake
3:32.857 howling_blast fluffy_pillow 36.0/100: 36% runic_power blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
3:33.861 frost_strike fluffy_pillow 48.0/100: 48% runic_power blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
3:34.864 defile fluffy_pillow 23.0/100: 23% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
3:35.868 frost_strike fluffy_pillow 35.0/100: 35% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
3:36.871 blood_tap fluffy_pillow 10.0/100: 10% runic_power blood_charge(6), unholy_strength, obliteration, frozen_wake
3:36.871 howling_blast fluffy_pillow 10.0/100: 10% runic_power blood_charge, unholy_strength, obliteration, frozen_wake
3:37.874 Waiting 1.000 sec 22.0/100: 22% runic_power blood_charge, unholy_strength, frozen_wake
3:38.874 howling_blast fluffy_pillow 22.0/100: 22% runic_power blood_charge, unholy_strength, frozen_wake
3:39.879 blood_boil fluffy_pillow 34.0/100: 34% runic_power blood_charge, unholy_strength, frozen_wake
3:40.885 frost_strike fluffy_pillow 46.0/100: 46% runic_power blood_charge, unholy_strength, frozen_wake
3:41.890 plague_leech fluffy_pillow 21.0/100: 21% runic_power blood_charge(3), unholy_strength, frozen_wake
3:42.895 howling_blast fluffy_pillow 21.0/100: 21% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
3:43.901 frost_strike fluffy_pillow 33.0/100: 33% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
3:44.907 howling_blast fluffy_pillow 8.0/100: 8% runic_power blood_charge(5), unholy_strength, frozen_wake
3:45.912 howling_blast fluffy_pillow 20.0/100: 20% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
3:46.916 frost_strike fluffy_pillow 32.0/100: 32% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
3:47.920 obliterate fluffy_pillow 7.0/100: 7% runic_power blood_charge(6), unholy_strength, frozen_wake
3:48.924 howling_blast fluffy_pillow 31.0/100: 31% runic_power blood_charge(6), rime, unholy_strength, frozen_wake
3:49.927 blood_tap fluffy_pillow 31.0/100: 31% runic_power blood_charge(6), unholy_strength, frozen_wake
3:49.927 howling_blast fluffy_pillow 31.0/100: 31% runic_power blood_charge, unholy_strength, frozen_wake
3:50.931 frost_strike fluffy_pillow 43.0/100: 43% runic_power blood_charge, unholy_strength, frozen_wake
3:51.934 plague_strike fluffy_pillow 18.0/100: 18% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
3:52.938 frost_strike fluffy_pillow 30.0/100: 30% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
3:53.941 howling_blast fluffy_pillow 5.0/100: 5% runic_power blood_charge(5), killing_machine, frozen_wake
3:54.946 howling_blast fluffy_pillow 17.0/100: 17% runic_power blood_charge(5), killing_machine, frozen_wake
3:55.950 frost_strike fluffy_pillow 29.0/100: 29% runic_power blood_charge(5), killing_machine, frozen_wake
3:56.954 blood_tap fluffy_pillow 4.0/100: 4% runic_power blood_charge(6), killing_machine, frozen_wake
3:56.954 howling_blast fluffy_pillow 4.0/100: 4% runic_power blood_charge, killing_machine, frozen_wake
3:57.959 plague_strike fluffy_pillow 16.0/100: 16% runic_power blood_charge, killing_machine, frozen_wake
3:58.965 frost_strike fluffy_pillow 28.0/100: 28% runic_power blood_charge, killing_machine, frozen_wake
3:59.968 howling_blast fluffy_pillow 3.0/100: 3% runic_power blood_charge(3), killing_machine, frozen_wake
4:00.973 antimagic_shell Death_Knight_Frost_1h_T18H 15.0/100: 15% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:00.973 pillar_of_frost fluffy_pillow 65.0/100: 65% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:00.973 frost_strike fluffy_pillow 65.0/100: 65% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:01.977 frost_strike fluffy_pillow 40.0/100: 40% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:02.982 howling_blast fluffy_pillow 15.0/100: 15% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:03.988 frost_strike fluffy_pillow 27.0/100: 27% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:04.991 defile fluffy_pillow 2.0/100: 2% runic_power blood_charge(8), pillar_of_frost, unholy_strength, frozen_wake
4:05.996 blood_tap fluffy_pillow 14.0/100: 14% runic_power blood_charge(8), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:05.996 howling_blast fluffy_pillow 14.0/100: 14% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:06.999 frost_strike fluffy_pillow 26.0/100: 26% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:08.002 blood_boil fluffy_pillow 1.0/100: 1% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:09.006 howling_blast fluffy_pillow 13.0/100: 13% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:10.011 frost_strike fluffy_pillow 25.0/100: 25% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:11.014 blood_tap fluffy_pillow 0.0/100: 0% runic_power blood_charge(6), pillar_of_frost, unholy_strength, frozen_wake
4:11.014 howling_blast fluffy_pillow 0.0/100: 0% runic_power blood_charge, pillar_of_frost, unholy_strength, frozen_wake
4:12.019 plague_leech fluffy_pillow 12.0/100: 12% runic_power blood_charge, pillar_of_frost, unholy_strength, frozen_wake
4:13.024 howling_blast fluffy_pillow 12.0/100: 12% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:14.029 howling_blast fluffy_pillow 24.0/100: 24% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:15.034 frost_strike fluffy_pillow 36.0/100: 36% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:16.036 obliterate fluffy_pillow 11.0/100: 11% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
4:17.039 howling_blast fluffy_pillow 35.0/100: 35% runic_power blood_charge(3), pillar_of_frost, rime, unholy_strength, obliteration, frozen_wake
4:18.043 howling_blast fluffy_pillow 35.0/100: 35% runic_power blood_charge(3), pillar_of_frost, unholy_strength, obliteration, frozen_wake
4:19.047 frost_strike fluffy_pillow 47.0/100: 47% runic_power blood_charge(3), pillar_of_frost, unholy_strength, obliteration, frozen_wake
4:20.051 blood_tap fluffy_pillow 22.0/100: 22% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
4:20.051 howling_blast fluffy_pillow 22.0/100: 22% runic_power killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
4:21.056 frost_strike fluffy_pillow 34.0/100: 34% runic_power killing_machine, unholy_strength, obliteration, frozen_wake
4:22.059 howling_blast fluffy_pillow 9.0/100: 9% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
4:23.065 howling_blast fluffy_pillow 21.0/100: 21% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
4:24.069 frost_strike fluffy_pillow 33.0/100: 33% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
4:25.074 plague_strike fluffy_pillow 8.0/100: 8% runic_power blood_charge(3), killing_machine, obliteration, frozen_wake
4:26.077 plague_strike fluffy_pillow 20.0/100: 20% runic_power blood_charge(3), killing_machine, obliteration, frozen_wake
4:27.082 frost_strike fluffy_pillow 32.0/100: 32% runic_power blood_charge(3), killing_machine, obliteration, frozen_wake
4:28.087 howling_blast fluffy_pillow 7.0/100: 7% runic_power blood_charge(5), killing_machine, frozen_wake
4:29.092 howling_blast fluffy_pillow 19.0/100: 19% runic_power blood_charge(5), killing_machine, frozen_wake
4:30.096 frost_strike fluffy_pillow 31.0/100: 31% runic_power blood_charge(5), killing_machine, frozen_wake
4:31.100 arcane_torrent fluffy_pillow 6.0/100: 6% runic_power archmages_greater_incandescence_str, blood_charge(6), killing_machine, frozen_wake
4:31.100 frost_strike fluffy_pillow 26.0/100: 26% runic_power archmages_greater_incandescence_str, blood_charge(6), killing_machine, frozen_wake
4:32.105 blood_tap fluffy_pillow 1.0/100: 1% runic_power archmages_greater_incandescence_str, blood_charge(8), killing_machine, frozen_wake
4:32.105 howling_blast fluffy_pillow 1.0/100: 1% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, frozen_wake
4:33.110 plague_strike fluffy_pillow 13.0/100: 13% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, frozen_wake
4:34.114 frost_strike fluffy_pillow 25.0/100: 25% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, frozen_wake
4:35.120 howling_blast fluffy_pillow 0.0/100: 0% runic_power archmages_greater_incandescence_str, blood_charge(5), frozen_wake
4:36.123 blood_boil fluffy_pillow 12.0/100: 12% runic_power archmages_greater_incandescence_str, blood_charge(5), frozen_wake
4:37.126 blood_tap fluffy_pillow 24.0/100: 24% runic_power archmages_greater_incandescence_str, blood_charge(5), killing_machine, unholy_strength, frozen_wake
4:37.126 defile fluffy_pillow 24.0/100: 24% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, frozen_wake
4:38.132 frost_strike fluffy_pillow 36.0/100: 36% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, frozen_wake
4:39.137 plague_leech fluffy_pillow 11.0/100: 11% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, unholy_strength, frozen_wake
4:40.144 howling_blast fluffy_pillow 11.0/100: 11% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, unholy_strength, frozen_wake
4:41.149 howling_blast fluffy_pillow 23.0/100: 23% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
4:42.152 frost_strike fluffy_pillow 35.0/100: 35% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
4:43.155 howling_blast fluffy_pillow 10.0/100: 10% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:44.160 howling_blast fluffy_pillow 22.0/100: 22% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:45.165 frost_strike fluffy_pillow 34.0/100: 34% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:46.169 plague_strike fluffy_pillow 9.0/100: 9% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
4:47.175 blood_tap fluffy_pillow 21.0/100: 21% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
4:47.175 howling_blast fluffy_pillow 21.0/100: 21% runic_power killing_machine, unholy_strength, frozen_wake
4:48.180 frost_strike fluffy_pillow 33.0/100: 33% runic_power killing_machine, unholy_strength, frozen_wake
4:49.184 howling_blast fluffy_pillow 8.0/100: 8% runic_power blood_charge, unholy_strength, frozen_wake
4:50.190 howling_blast fluffy_pillow 20.0/100: 20% runic_power blood_charge, unholy_strength, frozen_wake
4:51.193 frost_strike fluffy_pillow 32.0/100: 32% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
4:52.197 plague_strike fluffy_pillow 7.0/100: 7% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:53.202 Waiting 0.300 sec 19.0/100: 19% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:53.502 plague_strike fluffy_pillow 19.0/100: 19% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:54.505 frost_strike fluffy_pillow 31.0/100: 31% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
4:55.511 blood_tap fluffy_pillow 6.0/100: 6% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
4:55.511 soul_reaper fluffy_pillow 6.0/100: 6% runic_power killing_machine, unholy_strength, frozen_wake
4:56.516 howling_blast fluffy_pillow 18.0/100: 18% runic_power killing_machine, unholy_strength, frozen_wake
4:57.521 frost_strike fluffy_pillow 30.0/100: 30% runic_power killing_machine, unholy_strength, frozen_wake
4:58.527 howling_blast fluffy_pillow 5.0/100: 5% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
4:59.530 Waiting 1.200 sec 17.0/100: 17% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:00.730 plague_strike fluffy_pillow 17.0/100: 17% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:01.734 antimagic_shell Death_Knight_Frost_1h_T18H 29.0/100: 29% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:01.734 pillar_of_frost fluffy_pillow 79.0/100: 79% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:01.734 frost_strike fluffy_pillow 79.0/100: 79% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:02.738 frost_strike fluffy_pillow 54.0/100: 54% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:03.742 soul_reaper fluffy_pillow 29.0/100: 29% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:04.746 frost_strike fluffy_pillow 41.0/100: 41% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:05.750 blood_boil fluffy_pillow 16.0/100: 16% runic_power blood_charge(6), pillar_of_frost, unholy_strength, frozen_wake
5:06.754 blood_tap fluffy_pillow 28.0/100: 28% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:06.754 howling_blast fluffy_pillow 28.0/100: 28% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:07.757 frost_strike fluffy_pillow 40.0/100: 40% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:08.762 defile fluffy_pillow 15.0/100: 15% runic_power blood_charge(3), pillar_of_frost, unholy_strength, frozen_wake
5:09.766 frost_strike fluffy_pillow 27.0/100: 27% runic_power blood_charge(3), pillar_of_frost, unholy_strength, frozen_wake
5:10.769 soul_reaper fluffy_pillow 2.0/100: 2% runic_power blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake
5:11.772 howling_blast fluffy_pillow 14.0/100: 14% runic_power blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake
5:12.774 blood_tap fluffy_pillow 26.0/100: 26% runic_power blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake
5:12.774 howling_blast fluffy_pillow 26.0/100: 26% runic_power pillar_of_frost, unholy_strength, frozen_wake
5:13.778 frost_strike fluffy_pillow 38.0/100: 38% runic_power pillar_of_frost, unholy_strength, frozen_wake
5:14.781 plague_leech fluffy_pillow 13.0/100: 13% runic_power blood_charge, pillar_of_frost, unholy_strength, frozen_wake
5:15.785 obliterate fluffy_pillow 13.0/100: 13% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake
5:16.789 soul_reaper fluffy_pillow 37.0/100: 37% runic_power blood_charge, pillar_of_frost, rime, unholy_strength, obliteration, frozen_wake
5:17.793 howling_blast fluffy_pillow 49.0/100: 49% runic_power blood_charge, pillar_of_frost, rime, unholy_strength, obliteration, frozen_wake
5:18.795 frost_strike fluffy_pillow 49.0/100: 49% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake
5:19.799 howling_blast fluffy_pillow 24.0/100: 24% runic_power blood_charge(3), killing_machine, pillar_of_frost, obliteration, frozen_wake
5:20.802 frost_strike fluffy_pillow 36.0/100: 36% runic_power blood_charge(3), killing_machine, pillar_of_frost, obliteration, frozen_wake
5:21.805 howling_blast fluffy_pillow 11.0/100: 11% runic_power blood_charge(5), obliteration, frozen_wake
5:22.810 blood_tap fluffy_pillow 23.0/100: 23% runic_power blood_charge(5), obliteration, frozen_wake
5:22.810 soul_reaper fluffy_pillow 23.0/100: 23% runic_power obliteration, frozen_wake
5:23.814 frost_strike fluffy_pillow 35.0/100: 35% runic_power obliteration, frozen_wake
5:24.819 howling_blast fluffy_pillow 10.0/100: 10% runic_power blood_charge, unholy_strength, obliteration, frozen_wake
5:25.824 howling_blast fluffy_pillow 22.0/100: 22% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
5:26.829 frost_strike fluffy_pillow 34.0/100: 34% runic_power blood_charge, killing_machine, unholy_strength, obliteration, frozen_wake
5:27.834 plague_strike fluffy_pillow 9.0/100: 9% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
5:28.838 Waiting 1.300 sec 21.0/100: 21% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
5:30.138 plague_strike fluffy_pillow 21.0/100: 21% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
5:31.141 frost_strike fluffy_pillow 33.0/100: 33% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake
5:32.146 soul_reaper fluffy_pillow 8.0/100: 8% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
5:33.151 howling_blast fluffy_pillow 20.0/100: 20% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
5:34.155 frost_strike fluffy_pillow 32.0/100: 32% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
5:35.160 blood_tap fluffy_pillow 7.0/100: 7% runic_power blood_charge(6), killing_machine, unholy_strength, frozen_wake
5:35.160 blood_boil fluffy_pillow 7.0/100: 7% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:36.162 Waiting 1.200 sec 19.0/100: 19% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:37.362 plague_strike fluffy_pillow 19.0/100: 19% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:38.367 frost_strike fluffy_pillow 31.0/100: 31% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
5:39.372 soul_reaper fluffy_pillow 6.0/100: 6% runic_power blood_charge(3), unholy_strength, frozen_wake
5:40.376 defile fluffy_pillow 18.0/100: 18% runic_power blood_charge(3), frozen_wake
5:41.380 frost_strike fluffy_pillow 30.0/100: 30% runic_power blood_charge(3), frozen_wake
5:42.385 blood_tap fluffy_pillow 5.0/100: 5% runic_power blood_charge(5), killing_machine, frozen_wake
5:42.385 howling_blast fluffy_pillow 5.0/100: 5% runic_power killing_machine, frozen_wake
5:43.390 plague_leech fluffy_pillow 17.0/100: 17% runic_power killing_machine, frozen_wake
5:44.395 howling_blast fluffy_pillow 17.0/100: 17% runic_power killing_machine, frozen_wake
5:45.401 soul_reaper fluffy_pillow 29.0/100: 29% runic_power killing_machine, frozen_wake
5:46.405 frost_strike fluffy_pillow 41.0/100: 41% runic_power killing_machine, frozen_wake
5:47.407 obliterate fluffy_pillow 16.0/100: 16% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, frozen_wake
5:48.410 frost_strike fluffy_pillow 40.0/100: 40% runic_power archmages_greater_incandescence_str, blood_charge, killing_machine, obliteration, frozen_wake
5:49.416 howling_blast fluffy_pillow 15.0/100: 15% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, obliteration, frozen_wake
5:50.420 frost_strike fluffy_pillow 27.0/100: 27% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
5:51.427 blood_tap fluffy_pillow 2.0/100: 2% runic_power archmages_greater_incandescence_str, blood_charge(5), unholy_strength, obliteration, frozen_wake
5:51.427 soul_reaper fluffy_pillow 2.0/100: 2% runic_power archmages_greater_incandescence_str, unholy_strength, obliteration, frozen_wake
5:52.433 Waiting 0.100 sec 14.0/100: 14% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, obliteration, frozen_wake
5:52.533 howling_blast fluffy_pillow 14.0/100: 14% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, obliteration, frozen_wake
5:53.536 frost_strike fluffy_pillow 26.0/100: 26% runic_power archmages_greater_incandescence_str, killing_machine, unholy_strength, obliteration, frozen_wake
5:54.542 howling_blast fluffy_pillow 1.0/100: 1% runic_power archmages_greater_incandescence_str, blood_charge, unholy_strength, obliteration, frozen_wake
5:55.546 plague_strike fluffy_pillow 13.0/100: 13% runic_power archmages_greater_incandescence_str, blood_charge, unholy_strength, obliteration, frozen_wake
5:56.550 frost_strike fluffy_pillow 25.0/100: 25% runic_power archmages_greater_incandescence_str, blood_charge, unholy_strength, obliteration, frozen_wake
5:57.555 Waiting 2.000 sec 0.0/100: 0% runic_power blood_charge(3), unholy_strength, obliteration, frozen_wake
5:59.555 soul_reaper fluffy_pillow 0.0/100: 0% runic_power archmages_greater_incandescence_str, blood_charge(3), unholy_strength, frozen_wake
6:00.559 howling_blast fluffy_pillow 12.0/100: 12% runic_power archmages_greater_incandescence_str, blood_charge(3), unholy_strength, frozen_wake
6:01.564 arcane_torrent fluffy_pillow 24.0/100: 24% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
6:01.564 frost_strike fluffy_pillow 44.0/100: 44% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
6:02.569 antimagic_shell Death_Knight_Frost_1h_T18H 19.0/100: 19% runic_power archmages_greater_incandescence_str, blood_charge(5), unholy_strength, frozen_wake
6:02.569 pillar_of_frost fluffy_pillow 69.0/100: 69% runic_power archmages_greater_incandescence_str, blood_charge(5), unholy_strength, frozen_wake
6:02.569 blood_tap fluffy_pillow 69.0/100: 69% runic_power archmages_greater_incandescence_str, blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake
6:02.569 howling_blast fluffy_pillow 69.0/100: 69% runic_power archmages_greater_incandescence_str, pillar_of_frost, unholy_strength, frozen_wake
6:03.573 frost_strike fluffy_pillow 81.0/100: 81% runic_power archmages_greater_incandescence_str, pillar_of_frost, unholy_strength, frozen_wake
6:04.578 frost_strike fluffy_pillow 56.0/100: 56% runic_power archmages_greater_incandescence_str, blood_charge, pillar_of_frost, unholy_strength, frozen_wake
6:05.584 frost_strike fluffy_pillow 31.0/100: 31% runic_power archmages_greater_incandescence_str, blood_charge(3), pillar_of_frost, unholy_strength, frozen_wake
6:06.589 blood_tap fluffy_pillow 6.0/100: 6% runic_power archmages_greater_incandescence_str, blood_charge(5), pillar_of_frost, unholy_strength, frozen_wake
6:06.589 soul_reaper fluffy_pillow 6.0/100: 6% runic_power archmages_greater_incandescence_str, pillar_of_frost, unholy_strength, frozen_wake
6:07.594 blood_boil fluffy_pillow 18.0/100: 18% runic_power archmages_greater_incandescence_str, pillar_of_frost, unholy_strength, frozen_wake
6:08.598 howling_blast fluffy_pillow 30.0/100: 30% runic_power pillar_of_frost, unholy_strength, frozen_wake
6:09.603 frost_strike fluffy_pillow 42.0/100: 42% runic_power pillar_of_frost, frozen_wake
6:10.607 defile fluffy_pillow 17.0/100: 17% runic_power blood_charge, pillar_of_frost, frozen_wake
6:11.612 frost_strike fluffy_pillow 29.0/100: 29% runic_power blood_charge, pillar_of_frost, frozen_wake
6:12.616 plague_leech fluffy_pillow 4.0/100: 4% runic_power blood_charge(3), pillar_of_frost, frozen_wake
6:13.622 soul_reaper fluffy_pillow 4.0/100: 4% runic_power blood_charge(3), pillar_of_frost
6:14.627 howling_blast fluffy_pillow 16.0/100: 16% runic_power blood_charge(3), killing_machine, pillar_of_frost
6:15.633 frost_strike fluffy_pillow 28.0/100: 28% runic_power blood_charge(3), killing_machine, pillar_of_frost
6:16.641 howling_blast fluffy_pillow 3.0/100: 3% runic_power blood_charge(5), killing_machine, pillar_of_frost, frozen_wake
6:17.644 howling_blast fluffy_pillow 15.0/100: 15% runic_power blood_charge(5), killing_machine, pillar_of_frost, frozen_wake
6:18.649 frost_strike fluffy_pillow 27.0/100: 27% runic_power blood_charge(5), killing_machine, pillar_of_frost, frozen_wake
6:19.653 blood_tap fluffy_pillow 2.0/100: 2% runic_power blood_charge(6), pillar_of_frost, frozen_wake
6:19.653 soul_reaper fluffy_pillow 2.0/100: 2% runic_power blood_charge, pillar_of_frost, frozen_wake
6:20.658 plague_strike fluffy_pillow 14.0/100: 14% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
6:21.660 frost_strike fluffy_pillow 26.0/100: 26% runic_power blood_charge, killing_machine, pillar_of_frost, frozen_wake
6:22.664 howling_blast fluffy_pillow 1.0/100: 1% runic_power blood_charge(3), frozen_wake
6:23.669 plague_strike fluffy_pillow 13.0/100: 13% runic_power blood_charge(3), frozen_wake
6:24.674 howling_blast fluffy_pillow 25.0/100: 25% runic_power blood_charge(3), frozen_wake
6:25.678 frost_strike fluffy_pillow 37.0/100: 37% runic_power blood_charge(3), frozen_wake
6:26.683 blood_tap fluffy_pillow 12.0/100: 12% runic_power blood_charge(5), killing_machine, frozen_wake
6:26.683 soul_reaper fluffy_pillow 12.0/100: 12% runic_power killing_machine, frozen_wake
6:27.685 Waiting 0.300 sec 24.0/100: 24% runic_power killing_machine, unholy_strength, frozen_wake
6:27.985 plague_strike fluffy_pillow 24.0/100: 24% runic_power killing_machine, unholy_strength, frozen_wake
6:28.991 frost_strike fluffy_pillow 36.0/100: 36% runic_power killing_machine, unholy_strength, frozen_wake
6:29.995 howling_blast fluffy_pillow 11.0/100: 11% runic_power blood_charge, unholy_strength, frozen_wake
6:30.997 howling_blast fluffy_pillow 23.0/100: 23% runic_power blood_charge, unholy_strength, frozen_wake
6:32.004 frost_strike fluffy_pillow 35.0/100: 35% runic_power blood_charge, unholy_strength, frozen_wake
6:33.009 Waiting 2.200 sec 10.0/100: 10% runic_power blood_charge(3), unholy_strength, frozen_wake
6:35.209 soul_reaper fluffy_pillow 10.0/100: 10% runic_power blood_charge(3), unholy_strength, frozen_wake
6:36.213 plague_strike fluffy_pillow 22.0/100: 22% runic_power blood_charge(3), unholy_strength, frozen_wake
6:37.216 frost_strike fluffy_pillow 34.0/100: 34% runic_power blood_charge(3), unholy_strength, frozen_wake
6:38.220 blood_boil fluffy_pillow 9.0/100: 9% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
6:39.222 blood_tap fluffy_pillow 21.0/100: 21% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake
6:39.222 howling_blast fluffy_pillow 21.0/100: 21% runic_power killing_machine, unholy_strength, frozen_wake
6:40.227 frost_strike fluffy_pillow 33.0/100: 33% runic_power killing_machine, unholy_strength, frozen_wake
6:41.232 plague_leech fluffy_pillow 8.0/100: 8% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
6:42.237 soul_reaper fluffy_pillow 8.0/100: 8% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
6:43.241 obliterate fluffy_pillow 20.0/100: 20% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake
6:44.245 frost_strike fluffy_pillow 44.0/100: 44% runic_power blood_charge, killing_machine, rime, unholy_strength, obliteration, frozen_wake
6:45.249 defile fluffy_pillow 19.0/100: 19% runic_power blood_charge(3), rime, unholy_strength, obliteration, frozen_wake
6:46.253 howling_blast fluffy_pillow 31.0/100: 31% runic_power blood_charge(3), rime, unholy_strength, obliteration, frozen_wake
6:47.258 empower_rune_weapon fluffy_pillow 31.0/100: 31% runic_power blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
6:47.258 frost_strike fluffy_pillow 61.0/100: 61% runic_power blood_charge(3), killing_machine, unholy_strength, obliteration, frozen_wake
6:48.260 soul_reaper fluffy_pillow 36.0/100: 36% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
6:49.266 frost_strike fluffy_pillow 48.0/100: 48% runic_power blood_charge(5), killing_machine, unholy_strength, obliteration, frozen_wake
6:50.270 obliterate fluffy_pillow 23.0/100: 23% runic_power blood_charge(6), unholy_strength, obliteration, frozen_wake
6:51.276 howling_blast fluffy_pillow 47.0/100: 47% runic_power blood_charge(6), killing_machine, unholy_strength, obliteration, frozen_wake
6:52.280 frost_strike fluffy_pillow 59.0/100: 59% runic_power blood_charge(6), killing_machine, unholy_strength, obliteration, frozen_wake
6:53.284 frost_strike fluffy_pillow 34.0/100: 34% runic_power blood_charge(8), killing_machine, unholy_strength, obliteration, frozen_wake
6:54.289 soul_reaper fluffy_pillow 9.0/100: 9% runic_power archmages_greater_incandescence_str, blood_charge(10), killing_machine, unholy_strength, obliteration, frozen_wake
6:55.293 blood_tap fluffy_pillow 21.0/100: 21% runic_power archmages_greater_incandescence_str, blood_charge(10), killing_machine, unholy_strength, frozen_wake
6:55.293 howling_blast fluffy_pillow 21.0/100: 21% runic_power archmages_greater_incandescence_str, blood_charge(5), killing_machine, unholy_strength, frozen_wake
6:56.298 frost_strike fluffy_pillow 33.0/100: 33% runic_power archmages_greater_incandescence_str, blood_charge(5), killing_machine, unholy_strength, frozen_wake
6:57.303 howling_blast fluffy_pillow 8.0/100: 8% runic_power archmages_greater_incandescence_str, blood_charge(6), killing_machine, unholy_strength, frozen_wake
6:58.306 plague_strike fluffy_pillow 20.0/100: 20% runic_power archmages_greater_incandescence_str, blood_charge(6), killing_machine, unholy_strength, frozen_wake
6:59.311 frost_strike fluffy_pillow 32.0/100: 32% runic_power archmages_greater_incandescence_str, blood_charge(6), killing_machine, unholy_strength, frozen_wake
7:00.316 soul_reaper fluffy_pillow 7.0/100: 7% runic_power archmages_greater_incandescence_str, blood_charge(8), killing_machine, unholy_strength, frozen_wake
7:01.320 blood_tap fluffy_pillow 19.0/100: 19% runic_power archmages_greater_incandescence_str, blood_charge(8), killing_machine, unholy_strength, frozen_wake
7:01.320 howling_blast fluffy_pillow 19.0/100: 19% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
7:02.326 potion fluffy_pillow 31.0/100: 31% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake
7:02.326 frost_strike fluffy_pillow 31.0/100: 31% runic_power archmages_greater_incandescence_str, blood_charge(3), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:03.329 antimagic_shell Death_Knight_Frost_1h_T18H 6.0/100: 6% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:03.329 pillar_of_frost fluffy_pillow 56.0/100: 56% runic_power blood_charge(5), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:03.329 howling_blast fluffy_pillow 56.0/100: 56% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:04.333 frost_strike fluffy_pillow 68.0/100: 68% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:05.337 blood_tap fluffy_pillow 43.0/100: 43% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:05.337 howling_blast fluffy_pillow 43.0/100: 43% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:06.341 soul_reaper fluffy_pillow 55.0/100: 55% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:07.347 frost_strike fluffy_pillow 67.0/100: 67% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:08.351 frost_strike fluffy_pillow 42.0/100: 42% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:09.358 blood_tap fluffy_pillow 17.0/100: 17% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:09.358 obliterate fluffy_pillow 17.0/100: 17% runic_power killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:10.364 howling_blast fluffy_pillow 41.0/100: 41% runic_power killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:11.370 frost_strike fluffy_pillow 53.0/100: 53% runic_power killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:12.375 frost_strike fluffy_pillow 28.0/100: 28% runic_power blood_charge, killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:13.378 soul_reaper fluffy_pillow 3.0/100: 3% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:14.383 plague_leech fluffy_pillow 15.0/100: 15% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:15.388 defile fluffy_pillow 15.0/100: 15% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:16.393 frost_strike fluffy_pillow 27.0/100: 27% runic_power blood_charge(3), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:17.397 howling_blast fluffy_pillow 2.0/100: 2% runic_power blood_charge(5), pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:18.401 howling_blast fluffy_pillow 14.0/100: 14% runic_power blood_charge(5), pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:19.407 soul_reaper fluffy_pillow 26.0/100: 26% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:20.413 frost_strike fluffy_pillow 38.0/100: 38% runic_power blood_charge(5), killing_machine, pillar_of_frost, unholy_strength, obliteration, frozen_wake, draenic_strength_potion
7:21.416 howling_blast fluffy_pillow 13.0/100: 13% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:22.421 frost_strike fluffy_pillow 25.0/100: 25% runic_power blood_charge(6), killing_machine, pillar_of_frost, unholy_strength, frozen_wake, draenic_strength_potion
7:23.425 plague_strike fluffy_pillow 0.0/100: 0% runic_power blood_charge(8), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:24.430 blood_tap fluffy_pillow 12.0/100: 12% runic_power blood_charge(8), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:24.430 blood_boil fluffy_pillow 12.0/100: 12% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:25.434 soul_reaper fluffy_pillow 24.0/100: 24% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:26.439 frost_strike fluffy_pillow 36.0/100: 36% runic_power blood_charge(3), killing_machine, unholy_strength, frozen_wake, draenic_strength_potion
7:27.443 howling_blast fluffy_pillow 11.0/100: 11% runic_power blood_charge(5), unholy_strength, frozen_wake
7:28.446 blood_tap fluffy_pillow 23.0/100: 23% runic_power blood_charge(5), unholy_strength, frozen_wake
7:28.446 howling_blast fluffy_pillow 23.0/100: 23% runic_power unholy_strength, frozen_wake
7:29.450 frost_strike fluffy_pillow 35.0/100: 35% runic_power unholy_strength, frozen_wake
7:30.456 Waiting 0.100 sec 10.0/100: 10% runic_power blood_charge, killing_machine, unholy_strength, frozen_wake

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6712 6130 5911 (1038)
Agility 1126 1073 1073
Stamina 6713 6103 6103
Intellect 600 572 572
Spirit 638 638 638
Health 402780 366180 0
Runic Power 100 100 0
Crit 15.51% 10.51% 496
Haste 36.52% 28.19% 1488
Swing Speed 63.83% 53.82% 1488
Multistrike 32.80% 27.80% 1835
Damage / Heal Versatility 3.00% 0.00% 0
Attack Power 7383 6130 0
Mastery 50.02% 40.02% 1321
Armor 2376 2376 2376

Gear

Source Slot Average Item Level: 713.00
Local Head Demongaze Helm
ilevel: 710, stats: { 323 Armor, +352 Str, +528 Sta, +304 Mastery, +164 Haste }
Local Neck Corrupted Talonguard Pendant
ilevel: 710, stats: { +198 Str, +297 Sta, +177 Mult, +86 Mastery }, enchant: { +75 Mastery }
Local Shoulders Demongaze Pauldrons
ilevel: 710, stats: { 298 Armor, +264 Str, +396 Sta, +206 Mult, +146 Mastery }
Local Chest Demongaze Chestplate
ilevel: 710, stats: { 397 Armor, +352 Str, +528 Sta, +274 Mult, +194 Crit }
Local Waist Girdle of Demonic Wrath
ilevel: 710, stats: { 223 Armor, +264 StrInt, +396 Sta, +213 Mastery, +138 Haste }
Local Legs Demongaze Legplates
ilevel: 710, stats: { 347 Armor, +352 Str, +528 Sta, +294 Haste, +174 Mult }
Local Feet Treads of the Defiler
ilevel: 720, stats: { 282 Armor, +290 StrInt, +435 Sta, +276 Haste, +110 Mult }
Local Wrists Breach-Scarred Wristplates
ilevel: 715, stats: { 176 Armor, +207 StrInt, +311 Sta, +191 Haste, +85 Mastery }
Local Hands Gauntlets of Derision
ilevel: 715, stats: { 252 Armor, +277 StrInt, +415 Sta, +231 Mult, +137 Mastery }
Local Finger1 Spellbound Runic Band of Elemental Power
ilevel: 715, stats: { +207 Str, +311 Sta, +146 Crit, +125 Mult }, enchant: { +50 Mastery }
Local Finger2 Congealed Globule Loop
ilevel: 710, stats: { +198 Str, +297 Sta, +188 Mult, +75 Mastery }, enchant: { +50 Mastery }
Local Trinket1 Empty Drinking Horn
ilevel: 715, stats: { +456 Str }
Local Trinket2 Discordant Chorus
ilevel: 715, stats: { +456 Str }
Local Back Soulbinder's Greatcloak
ilevel: 710, stats: { 78 Armor, +198 Str, +297 Sta, +177 Haste, +86 Mult }, enchant: { +100 Mastery }
Local Main Hand Fiendsbreath Warmace
ilevel: 715, weapon: { 936 - 1740, 2.6 }, stats: { +158 Str, +237 Sta, +132 Mult, +78 Crit }, enchant: rune_of_razorice
Local Off Hand Fiendsbreath Warmace
ilevel: 715, weapon: { 936 - 1740, 2.6 }, stats: { +158 Str, +237 Sta, +132 Mult, +78 Crit }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Plaguebearer Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Blood Tap Runic Empowerment Runic Corruption
75 Death Pact Death Siphon Conversion
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground
100 Necrotic Plague Defile Breath of Sindragosa

Profile

deathknight="Death_Knight_Frost_1h_T18H"
level=100
race=blood_elf
role=attack
position=back
talents=2001002
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=buttered_sturgeon
actions.precombat+=/horn_of_winter
actions.precombat+=/frost_presence
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/army_of_the_dead
actions.precombat+=/potion,name=draenic_strength
actions.precombat+=/pillar_of_frost

# Executed every time the actor is available.

actions=auto_attack
actions+=/deaths_advance,if=movement.remains>2
actions+=/antimagic_shell,damage=100000,if=((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
actions+=/pillar_of_frost
actions+=/potion,name=draenic_strength,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.potion.up
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/plague_leech,if=disease.min_remains<1
actions+=/soul_reaper,if=target.health.pct-3*(target.health.pct%target.time_to_die)<=35
actions+=/blood_tap,if=(target.health.pct-3*(target.health.pct%target.time_to_die)<=35&cooldown.soul_reaper.remains=0)
actions+=/run_action_list,name=single_target_2h,if=spell_targets.howling_blast<4&main_hand.2h
actions+=/run_action_list,name=single_target_1h,if=spell_targets.howling_blast<3&main_hand.1h
actions+=/run_action_list,name=multi_target,if=spell_targets.howling_blast>=3+main_hand.2h

actions.multi_target_bos=howling_blast
actions.multi_target_bos+=/blood_tap,if=buff.blood_charge.stack>10
actions.multi_target_bos+=/death_and_decay,if=unholy=1
actions.multi_target_bos+=/plague_strike,if=unholy=2
actions.multi_target_bos+=/blood_tap
actions.multi_target_bos+=/plague_leech
actions.multi_target_bos+=/plague_strike,if=unholy=1
actions.multi_target_bos+=/empower_rune_weapon

actions.single_target_bos=obliterate,if=buff.killing_machine.react
actions.single_target_bos+=/blood_tap,if=buff.killing_machine.react&buff.blood_charge.stack>=5
actions.single_target_bos+=/plague_leech,if=buff.killing_machine.react
actions.single_target_bos+=/blood_tap,if=buff.blood_charge.stack>=5
actions.single_target_bos+=/plague_leech
actions.single_target_bos+=/obliterate,if=runic_power<76
actions.single_target_bos+=/howling_blast,if=((death=1&frost=0&unholy=0)|death=0&frost=1&unholy=0)&runic_power<88

actions.multi_target=unholy_blight
actions.multi_target+=/frost_strike,if=buff.killing_machine.react&main_hand.1h
actions.multi_target+=/obliterate,if=unholy>1
actions.multi_target+=/blood_boil,if=dot.blood_plague.ticking&(!talent.unholy_blight.enabled|cooldown.unholy_blight.remains<49),line_cd=28
actions.multi_target+=/defile
actions.multi_target+=/breath_of_sindragosa,if=runic_power>75
actions.multi_target+=/run_action_list,name=multi_target_bos,if=dot.breath_of_sindragosa.ticking
actions.multi_target+=/howling_blast
actions.multi_target+=/blood_tap,if=buff.blood_charge.stack>10
actions.multi_target+=/frost_strike,if=runic_power>88
actions.multi_target+=/death_and_decay,if=unholy=1
actions.multi_target+=/plague_strike,if=unholy=2&!dot.blood_plague.ticking&!talent.necrotic_plague.enabled
actions.multi_target+=/blood_tap
actions.multi_target+=/frost_strike,if=!talent.breath_of_sindragosa.enabled|cooldown.breath_of_sindragosa.remains>=10
actions.multi_target+=/plague_leech
actions.multi_target+=/plague_strike,if=unholy=1
actions.multi_target+=/empower_rune_weapon

actions.single_target_1h=breath_of_sindragosa,if=runic_power>75
actions.single_target_1h+=/run_action_list,name=single_target_bos,if=dot.breath_of_sindragosa.ticking
actions.single_target_1h+=/frost_strike,if=buff.killing_machine.react
actions.single_target_1h+=/obliterate,if=unholy>1|buff.killing_machine.react
actions.single_target_1h+=/defile
actions.single_target_1h+=/blood_tap,if=talent.defile.enabled&cooldown.defile.remains=0
actions.single_target_1h+=/frost_strike,if=runic_power>88
actions.single_target_1h+=/howling_blast,if=buff.rime.react|death>1|frost>1
actions.single_target_1h+=/blood_tap,if=buff.blood_charge.stack>10
actions.single_target_1h+=/frost_strike,if=runic_power>76
actions.single_target_1h+=/unholy_blight,if=!disease.ticking
actions.single_target_1h+=/outbreak,if=!dot.blood_plague.ticking
actions.single_target_1h+=/plague_strike,if=!talent.necrotic_plague.enabled&!dot.blood_plague.ticking
actions.single_target_1h+=/howling_blast,if=!(target.health.pct-3*(target.health.pct%target.time_to_die)<=35&cooldown.soul_reaper.remains<3)|death+frost>=2
actions.single_target_1h+=/outbreak,if=talent.necrotic_plague.enabled&debuff.necrotic_plague.stack<=14
actions.single_target_1h+=/blood_tap
actions.single_target_1h+=/plague_leech
actions.single_target_1h+=/empower_rune_weapon

actions.single_target_2h=defile
actions.single_target_2h+=/blood_tap,if=talent.defile.enabled&cooldown.defile.remains=0
actions.single_target_2h+=/howling_blast,if=buff.rime.react&disease.min_remains>5&buff.killing_machine.react
actions.single_target_2h+=/obliterate,if=buff.killing_machine.react
actions.single_target_2h+=/blood_tap,if=buff.killing_machine.react
actions.single_target_2h+=/howling_blast,if=!talent.necrotic_plague.enabled&!dot.frost_fever.ticking&buff.rime.react
actions.single_target_2h+=/outbreak,if=!disease.max_ticking
actions.single_target_2h+=/unholy_blight,if=!disease.min_ticking
actions.single_target_2h+=/breath_of_sindragosa,if=runic_power>75
actions.single_target_2h+=/run_action_list,name=single_target_bos,if=dot.breath_of_sindragosa.ticking
actions.single_target_2h+=/obliterate,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains<7&runic_power<76
actions.single_target_2h+=/howling_blast,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains<3&runic_power<88
actions.single_target_2h+=/howling_blast,if=!talent.necrotic_plague.enabled&!dot.frost_fever.ticking
actions.single_target_2h+=/howling_blast,if=talent.necrotic_plague.enabled&!dot.necrotic_plague.ticking
actions.single_target_2h+=/plague_strike,if=!talent.necrotic_plague.enabled&!dot.blood_plague.ticking
actions.single_target_2h+=/blood_tap,if=buff.blood_charge.stack>10&runic_power>76
actions.single_target_2h+=/frost_strike,if=runic_power>76
actions.single_target_2h+=/howling_blast,if=buff.rime.react&disease.min_remains>5&(blood.frac>=1.8|unholy.frac>=1.8|frost.frac>=1.8)
actions.single_target_2h+=/obliterate,if=blood.frac>=1.8|unholy.frac>=1.8|frost.frac>=1.8
actions.single_target_2h+=/plague_leech,if=disease.min_remains<3&((blood.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&blood.frac<=0.95))
actions.single_target_2h+=/frost_strike,if=talent.runic_empowerment.enabled&(frost=0|unholy=0|blood=0)&(!buff.killing_machine.react|!obliterate.ready_in<=1)
actions.single_target_2h+=/frost_strike,if=talent.blood_tap.enabled&buff.blood_charge.stack<=10&(!buff.killing_machine.react|!obliterate.ready_in<=1)
actions.single_target_2h+=/howling_blast,if=buff.rime.react&disease.min_remains>5
actions.single_target_2h+=/obliterate,if=blood.frac>=1.5|unholy.frac>=1.6|frost.frac>=1.6|buff.bloodlust.up|cooldown.plague_leech.remains<=4
actions.single_target_2h+=/blood_tap,if=(buff.blood_charge.stack>10&runic_power>=20)|(blood.frac>=1.4|unholy.frac>=1.6|frost.frac>=1.6)
actions.single_target_2h+=/frost_strike,if=!buff.killing_machine.react
actions.single_target_2h+=/plague_leech,if=(blood.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&blood.frac<=0.95)
actions.single_target_2h+=/empower_rune_weapon

head=demongaze_helm,id=124332,bonus_id=566
neck=corrupted_talonguard_pendant,id=124218,bonus_id=566,enchant=gift_of_mastery
shoulders=demongaze_pauldrons,id=124344,bonus_id=566
back=soulbinders_greatcloak,id=124143,bonus_id=566,enchant=gift_of_mastery
chest=demongaze_chestplate,id=124317,bonus_id=566
wrists=breachscarred_wristplates,id=124353,bonus_id=566
hands=gauntlets_of_derision,id=124326,bonus_id=566
waist=girdle_of_demonic_wrath,id=124350,bonus_id=566
legs=demongaze_legplates,id=124338,bonus_id=566
feet=treads_of_the_defiler,id=124322,bonus_id=566
finger1=spellbound_runic_band_of_elemental_power,id=118305,enchant=gift_of_mastery
finger2=congealed_globule_loop,id=124197,bonus_id=566,enchant=gift_of_mastery
trinket1=empty_drinking_horn,id=124238,bonus_id=566
trinket2=discordant_chorus,id=124237,bonus_id=566
main_hand=fiendsbreath_warmace,id=124374,bonus_id=566,enchant=rune_of_razorice
off_hand=fiendsbreath_warmace,id=124374,bonus_id=566,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=712.81
# gear_strength=4387
# gear_stamina=5213
# gear_crit_rating=496
# gear_haste_rating=1240
# gear_mastery_rating=1321
# gear_multistrike_rating=1835
# gear_armor=2376
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Death_Knight_Frost_2h_T18H : 92048 dps, 47444 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
92048.1 92048.1 38.8 / 0.042% 6677.4 / 7.3% 11103.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.3 Runic Power 6.42% 65.7 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Death_Knight_Frost_2h_T18H 92048
auto_attack_mh 7488 8.1% 235.2 1.92sec 14333 7494 Direct 235.2 11123 23508 12494 11.1% 115.3 3337 7055 11.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 235.17 235.17 0.00 0.00 1.9125 0.0000 3370521.86 5179959.91 34.93 7494.08 7494.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.76 11.06% 7054.54 5274 9879 7056.74 5590 8525 90030 138361 34.93
multistrike 102.58 88.94% 3336.94 2637 4660 3338.21 3143 3549 342317 526087 34.93
hit 209.13 88.93% 11122.75 8790 15533 11127.02 10700 11603 2326086 3574826 34.93
crit 26.04 11.07% 23508.38 17580 32931 23515.29 21054 26325 612090 940685 34.93
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Death and Decay 2398 2.6% 14.2 32.16sec 76080 75745 Periodic 617.8 1356 2868 1524 11.1% 303.4 407 861 11.1% 124.5%

Stats details: death_and_decay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.20 56.78 617.79 617.79 1.0045 0.9081 1080046.98 1080046.98 0.00 1877.49 75744.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.48 88.89% 0.00 0 0 0.00 0 0 0 0 0.00
crit 6.31 11.11% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 33.7 11.11% 860.56 610 1297 860.78 756 982 29014 29014 0.00
multistrike 269.7 88.89% 406.88 305 612 406.97 364 444 109721 109721 0.00
hit 549.4 88.93% 1356.29 1016 2039 1356.58 1223 1477 745133 745133 0.00
crit 68.4 11.07% 2868.28 2033 4323 2869.02 2488 3210 196179 196179 0.00
 
 

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:unholy=1
Spelldata
  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every sec.$?$w4!=0[ Movement speed reduced by $w4%.][]
  • description:Corrupts the ground targeted by the Death Knight, causing ${$52212m1*10} Shadow damage over {$d=10 seconds} to targets within the area{$?s58629=false}[ and reducing their movement speed by {$58629s1=50}%][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.132000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
 
Fel Burn 4178 4.5% 111.6 8.24sec 16860 0 Periodic 1645.6 887 1877 997 11.1% 807.0 266 562 11.1% 365.3%

Stats details: fel_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.63 111.63 1645.55 1645.55 0.0000 1.0000 1882048.67 1882048.67 0.00 1143.72 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 89.6 11.10% 562.42 93 2554 562.41 362 838 50399 50399 0.00
multistrike 717.4 88.90% 266.27 46 1205 266.30 238 301 191029 191029 0.00
hit 1463.1 88.91% 887.30 154 4016 887.41 844 935 1298167 1298167 0.00
crit 182.5 11.09% 1876.50 309 8515 1876.41 1490 2415 342455 342455 0.00
 
 

Action details: fel_burn

Static Values
  • id:184256
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184256
  • name:Fel Burn
  • school:fire
  • tooltip:Burning for $w1 Fire damage every $t1 sec. Successive attacks add stacks but do not refresh duration.
  • description:{[email protected]=Your attacks cause the target to burn for $184256o1 Fire damage over {$184256d=15 seconds}. Successive attacks do not refresh Fel Burn's duration, but instead add an additional stack of Fel Burn.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:148.79
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Fel Cleave 7190 7.8% 78.8 5.74sec 41085 0 Direct 315.2 7971 16845 8955 11.1% 154.5 2391 5053 11.1%  

Stats details: fel_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.80 315.19 0.00 0.00 0.0000 0.0000 3237402.03 4975375.75 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.11 11.07% 5053.31 4783 5070 5053.18 4942 5070 86462 132878 34.93
multistrike 137.42 88.93% 2391.36 2391 2391 2391.36 2391 2391 328613 505027 34.93
hit 280.26 88.92% 7971.19 7971 7971 7971.19 7971 7971 2234002 3433308 34.93
crit 34.93 11.08% 16844.52 15942 16899 16843.90 16561 16899 588326 904164 34.93
 
 

Action details: fel_cleave

Static Values
  • id:184248
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184248
  • name:Fel Cleave
  • school:physical
  • tooltip:
  • description:{[email protected]=Your melee attacks have a chance to trigger a Fel Cleave, dealing {$184248s1=4399} damage to all enemies in front of you. (Approximately ${$procrppm}.2 procs per minute)}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11816.13
  • base_dd_max:11816.13
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Frost Strike 14367 15.6% 148.6 3.00sec 43556 43361 Direct 148.6 21264 44666 37961 71.4% 73.0 6380 13404 71.4%  

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.61 148.61 0.00 0.00 1.0045 0.0000 6472900.38 6472900.38 0.00 43361.09 43361.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 52.11 71.42% 13403.83 10074 18697 13406.95 12439 14565 698409 698409 0.00
multistrike 20.85 28.58% 6380.07 5037 8819 6380.93 5616 7489 133038 133038 0.00
hit 42.57 28.65% 21263.93 16790 29398 21268.89 19361 24081 905301 905301 0.00
crit 106.04 71.35% 44665.64 33581 62323 44675.50 42537 47133 4736153 4736153 0.00
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:buff.killing_machine.react&main_hand.1h
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy, causing $sw1 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.88
 
Howling Blast 32476 35.3% 169.3 2.66sec 86393 86006 Direct 677.1 16758 35401 18827 11.1% 332.1 5028 10617 11.1%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.26 677.06 0.00 0.00 1.0045 0.0000 14623295.74 14623295.74 0.00 86006.23 86006.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 36.90 11.11% 10617.11 7379 18835 10621.38 9471 12322 391749 391749 0.00
multistrike 295.24 88.89% 5027.90 3690 8885 5030.37 4745 5399 1484449 1484449 0.00
hit 601.92 88.90% 16758.12 12299 29615 16766.80 15972 17788 10086962 10086962 0.00
crit 75.14 11.10% 35401.01 24598 62785 35419.57 32254 39274 2660135 2660135 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever. |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {[email protected]=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
 
Necrotic Plague 14984 16.3% 932.1 1.72sec 7236 0 Periodic 863.5 6062 12815 6810 11.1% 423.3 1818 3844 11.1% 383.3%

Stats details: necrotic_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 932.11 932.11 863.46 863.46 0.0000 2.0000 6745188.30 6745188.30 0.00 3905.92 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 932.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 47.0 11.11% 3843.76 237 7549 3845.70 2880 4788 180759 180759 0.00
multistrike 376.3 88.89% 1818.23 119 3561 1819.48 1655 2028 684165 684165 0.00
hit 767.7 88.91% 6061.55 395 11869 6065.42 5727 6591 4653717 4653717 0.00
crit 95.7 11.09% 12814.64 790 25162 12822.90 10263 14931 1226548 1226548 0.00
 
 

Action details: necrotic_plague

Static Values
  • id:155159
  • school:shadowfrost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:155159
  • name:Necrotic Plague
  • school:shadowfrost
  • tooltip:Suffering $w1 Shadowfrost damage every $t1 sec. Each time it deals damage, it gains 1 stack, and infects another nearby enemy if possible.$?$w2>0[ The Death Knight will gain ${$155165m~1/10} Runic Power whenever an infected target attempts to attack them.][]
  • description:{[email protected]=A powerful disease that deals {$155159s1=1} Shadowfrost damage per stack every $155159t1 sec for {$155159d=30 seconds}. Each time it deals damage, it gains 1 stack, and infects another nearby enemy within {$s2=8} yards if possible. $?c1[ You gain ${$155165m1/10} Runic Power whenever a target infected with Necrotic Plague attempts to attack you.][] Replaces Blood Plague and Frost Fever, and is applied by any ability which applied either. This effect cannot be refreshed; it gains 1 stack instead.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.035200
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Obliterate 3374 3.6% 19.5 21.83sec 77310 76963 Direct 19.5 40045 84159 67386 62.0% 9.6 11986 25221 62.1%  

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.52 19.52 0.00 0.00 1.0045 0.0000 1508867.06 2318890.43 34.93 76963.38 76963.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.95 62.08% 25221.37 18233 33841 25161.75 0 33841 150109 230695 34.82
multistrike 3.64 37.92% 11985.61 9117 15963 11616.75 0 15963 43578 66973 33.83
hit 7.42 38.02% 40044.89 30389 53209 40090.42 30389 53209 297166 456698 34.93
crit 12.10 61.98% 84158.81 60778 112804 84234.33 73199 98116 1018013 1564526 34.93
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:buff.killing_machine.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack that deals $sw1 Physical damage and has a {$59057h=45}% chance to cause your next Howling Blast or Icy Touch to consume no runes.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.56
 
Plague Strike 575 0.6% 38.8 9.84sec 6694 6664 Direct 38.8 5199 10993 5838 11.0% 19.0 1560 3301 11.0%  

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.80 38.80 0.00 0.00 1.0045 0.0000 259761.43 399212.31 34.93 6664.48 6664.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.09 11.02% 3301.19 2564 4760 2859.14 0 4760 6904 10611 30.25
multistrike 16.89 88.98% 1559.66 1282 2245 1559.53 1372 1801 26342 40483 34.93
hit 34.53 88.98% 5198.87 4274 7484 5197.99 4705 5586 179492 275851 34.93
crit 4.28 11.02% 10992.77 8548 15865 10856.88 0 15865 47023 72267 34.49
 
 

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:unholy=2
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals $sw3 Physical damage and infects the target with Blood Plague{$?s51160=false}[ and Frost Fever][]. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {[email protected]=A disease that deals Shadow damage every $t1 sec for {$d=30 seconds}.} {$?s51160=false}[ |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {[email protected]=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}][]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
Soul Reaper 4728 5.1% 24.3 6.64sec 87483 87091 Direct 24.3 14622 30916 16444 11.2% 12.0 4383 9298 11.1%  
Periodic 23.6 54906 116085 61675 11.1% 11.6 16471 34937 11.1% 26.2%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.31 24.31 23.57 23.57 1.0045 5.0000 2126423.26 2372620.43 10.38 14948.81 87091.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.32 11.07% 9298.48 6956 13029 6849.63 0 13029 12308 18915 25.73
multistrike 10.63 88.93% 4383.11 3478 6146 4385.39 3610 5346 46595 71610 34.93
hit 21.59 88.82% 14622.25 11593 20486 14629.21 13473 16025 315681 485152 34.93
crit 2.72 11.18% 30916.14 23185 43430 29123.50 0 43430 84018 129122 32.89
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.3 11.11% 34937.49 24625 52378 25570.64 0 52378 44913 44913 0.00
multistrike 10.3 88.89% 16471.36 12312 24707 16483.06 13191 20171 169441 169441 0.00
hit 21.0 88.94% 54906.08 41041 82356 54937.99 49772 61333 1150769 1150769 0.00
crit 2.6 11.06% 116084.52 82082 174594 108409.02 0 174594 302698 302698 0.00
 
 

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:target.health.pct-3*(target.health.pct%target.time_to_die)<=35
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadowfrost damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.
  • description:Strikes an enemy for $sw1 Physical damage and afflicts the target with Soul Reaper. After {$d=5 seconds}, if the target is below $?p138347[{$138347s1=45}][35]% health, this effect will deal {$114867s1=0} additional Shadowfrost damage. If the enemy dies before this effect triggers, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.27
 

Action details: soul_reaper_execute

Static Values
  • id:114867
  • school:shadowfrost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{[email protected]=Strikes an enemy for $sw1 Physical damage, afflicts the target with Soul Reaper, and increases the healing from your next Death Strike by {$50421s1=20}%. After {$d=5 seconds}, if the target is below $?p138347[{$138347s1=45}][35]% health, this effect will deal {$114867s1=0} additional Shadowfrost damage. If the enemy dies before this effect triggers, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.}
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
pet - army_of_the_dead 3695 / 292
auto_attack_mh 2313 0.2% 329.4 0.83sec 246 293 Direct 329.4 193 386 214 11.1% 161.6 58 116 11.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 329.37 329.37 0.00 0.00 0.8395 0.0000 80948.16 124404.55 34.93 292.76 292.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.97 11.11% 115.70 71 143 115.72 92 141 2079 3195 34.93
multistrike 143.67 88.89% 57.86 36 72 57.86 51 65 8312 12775 34.93
hit 292.88 88.92% 192.85 119 238 192.85 175 212 56482 86804 34.93
crit 36.50 11.08% 385.67 238 477 385.71 321 455 14075 21631 34.93
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Claw 1383 0.1% 154.7 1.99sec 313 0 Direct 154.7 245 491 273 11.0% 76.0 74 147 11.2%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 154.74 154.74 0.00 0.00 0.0000 0.0000 48393.42 74373.04 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.54 11.24% 147.38 89 179 147.42 102 179 1258 1933 34.93
multistrike 67.42 88.76% 73.62 45 89 73.63 65 83 4963 7628 34.93
hit 137.65 88.95% 245.42 149 298 245.44 223 270 33781 51915 34.93
crit 17.09 11.05% 490.93 297 596 490.94 351 596 8392 12897 34.93
 
 

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=1}% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.25
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Death_Knight_Frost_2h_T18H 0
Simple Action Stats Execute Interval
Death_Knight_Frost_2h_T18H
Anti-Magic Shell 8.0 60.45sec

Stats details: antimagic_shell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 7.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: antimagic_shell

Static Values
  • id:48707
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Death_Knight_Frost_2h_T18H
  • harmful:false
  • if_expr:((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
Spelldata
  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to $w1 magic damage. Immune to magic debuffs.
  • description:Surrounds the Death Knight in an Anti-Magic Shell for {$d=5 seconds}, absorbing {$s1=100}% of all magical damage and preventing application of harmful magical effects. {$?s159415=false}[][Damage absorbed generates Runic Power.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Arcane Torrent 5.5 90.45sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 5.49 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:50613
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore ${$m2/10} Runic Power. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Army of the Dead 1.0 0.00sec

Stats details: army_of_the_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 15.00 15.00 0.0000 0.2446 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.89 88.87% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.11 11.13% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: army_of_the_dead

Static Values
  • id:42650
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning Ghouls.
  • description:Summons a legion of Ghouls over {$d=4 seconds} who will fight for the Death Knight for {$42651d=40 seconds}, swarming the area, taunting and fighting anything they can.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:30.00
 
Blood Tap 49.1 8.99sec

Stats details: blood_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.06 49.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.67 89.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.39 10.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:(target.health.pct-3*(target.health.pct%target.time_to_die)<=35&cooldown.soul_reaper.remains=0)
Spelldata
  • id:45529
  • name:Blood Tap
  • school:physical
  • tooltip:
  • description:Every {$s1=15} Runic Power you spend will generate a Blood Charge. Max {$114851u=12} charges. Blood Tap consumes {$114851s1=5} Blood Charges to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Draenic Strength Potion (potion) 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156428
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your Strength by {$s1=1000} for {$d=25 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Empower Rune Weapon 1.9 305.65sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.92 1.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.71 89.04% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.21 10.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
 
frost_presence 1.0 0.00sec

Stats details: frost_presence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.89 88.81% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.11 11.19% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: frost_presence

Static Values
  • id:48266
  • school:none
  • resource:runic_power
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Horn of Winter 1.0 0.00sec

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.89 88.59% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.11 11.41% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by {$s1=10}%.
  • description:The Death Knight blows the Horn of Winter, increasing attack power of all party and raid members within $a1 yards by {$s1=10}% for {$d=3600 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Outbreak 0.0 0.00sec

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.0046 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {[email protected]=A disease that deals Shadow damage every $t1 sec for {$d=30 seconds}.} |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {[email protected]=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Pillar of Frost 8.0 60.45sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 7.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.09 89.00% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.88 11.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Movement speed reduced by {$90259s2=70}%.][ Immune to movement from external sources.]
  • description:The power of Frost increases the Death Knight's Strength by {$s1=15}%, and grants immunity to external movement effects such as knockbacks{$?s58635=false}[, and immunity to all effects that cause loss of control, but also reducing movement speed by {$90259s2=70}% while active][]. Lasts {$d=20 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Unholy Blight 5.5 90.51sec

Stats details: unholy_blight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.48 5.48 54.06 216.25 1.0045 1.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 192.1 88.84% 0.00 0 0 0.00 0 0 0 0 0.00
crit 24.1 11.16% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: unholy_blight

Static Values
  • id:115989
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115989
  • name:Unholy Blight
  • school:shadow
  • tooltip:Surrounded by a vile swarm of unholy insects. Infecting nearby enemies with Blood Plague and Frost Fever every $t1 sec.
  • description:Surrounds the Death Knight with a vile swarm of unholy insects for {$115989d=10 seconds}, stinging all enemies within $115994A1 yards, infecting them with Blood Plague and Frost Fever.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 

Action details: unholy_blight_tick

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fluffy_pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Unholy Strength 40.3 11.27sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 40.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Death_Knight_Frost_2h_T18H
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=3}% and increase total Strength by {$53365s1=20}% for {$53365d=15 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Archmage's Greater Incandescence (_str) 8.5 0.0 53.8sec 53.1sec 18.77% 18.79% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_archmages_greater_incandescence_str
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • archmages_greater_incandescence_str_1:18.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177175
  • name:Archmage's Greater Incandescence
  • tooltip:Increases Strength by 15% for {$d=10 seconds}.
  • description:Increases Strength by 15% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Charge 49.2 99.4 9.1sec 3.0sec 77.31% 77.32% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_blood_charge
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blood_charge_1:28.48%
  • blood_charge_3:32.80%
  • blood_charge_5:15.81%
  • blood_charge_6:0.20%
  • blood_charge_8:0.02%
  • blood_charge_10:0.00%
  • blood_charge_11:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114851
  • name:Blood Charge
  • tooltip:Stored blood energy. Blood Tap consumes 5 Blood Charges to activate a random fully-depleted rune as a Death Rune.
  • description:{[email protected]=Every {$s1=15} Runic Power you spend will generate a Blood Charge. Max {$114851u=12} charges. Blood Tap consumes {$114851s1=5} Blood Charges to activate a random fully-depleted rune as a Death Rune.}
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 26.42% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Draenic Strength Potion 2.0 0.0 406.1sec 0.0sec 10.82% 10.84% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:10.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your Strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Frozen Wake 4.9 101.1 89.4sec 4.2sec 95.50% 94.92% 101.1(101.1)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_frozen_wake
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frozen_wake_1:95.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187894
  • name:Frozen Wake
  • tooltip:Critical damage increased by $w1%.
  • description:{[email protected]=When you critically hit with Obliterate you gain $187893m1% haste for {$187893d=12 seconds}. When you critically hit with Frost Strike, your critical damage is increased by $187894m1% for {$187894d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Killing Machine 41.8 42.6 10.8sec 5.3sec 58.79% 66.53% 42.6(42.6)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:58.79%

Trigger Attempt Success

  • trigger_pct:35.89%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to cause your next Obliterate or Frost Strike to be a guaranteed critical strike.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Obliteration 7.4 4.7 59.0sec 34.4sec 27.19% 55.27% 4.7(4.7)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_obliteration
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • obliteration_1:27.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187893
  • name:Obliteration
  • tooltip:Melee haste increased by $w1%.
  • description:{[email protected]=When you critically hit with Obliterate you gain $187893m1% haste for {$187893d=12 seconds}. When you critically hit with Frost Strike, your critical damage is increased by $187894m1% for {$187894d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Pillar of Frost 8.0 0.0 60.4sec 60.4sec 34.58% 37.63% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:34.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Movement speed reduced by {$90259s2=70}%.][ Immune to movement from external sources.]
  • description:The power of Frost increases the Death Knight's Strength by {$s1=15}%, and grants immunity to external movement effects such as knockbacks{$?s58635=false}[, and immunity to all effects that cause loss of control, but also reducing movement speed by {$90259s2=70}% while active][]. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Freezing Fog (rime) 8.8 0.0 45.3sec 45.3sec 2.06% 2.09% 0.0(0.0)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:2.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 12.9 27.4 36.0sec 11.3sec 79.34% 76.42% 27.4(27.4)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:79.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=20}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=3}% and increase total Strength by {$53365s1=20}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
buttered_sturgeon_food

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_buttered_sturgeon_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:125.00

Stack Uptimes

  • buttered_sturgeon_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Presence

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by {$s5=20}%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by {$s1=20}%, {$?s50385=false}[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by {$s5=20}%. Activating a new Presence will cancel this one and consume {$?s58647=false}[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Strength Flask

Buff details

  • buff initial source:Death_Knight_Frost_2h_T18H
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_2h_T18H
frost_strike Runic Power 148.6 3715.3 25.0 25.0 1742.2
pet - army_of_the_dead
claw Energy 154.7 6189.6 40.0 40.0 7.8
Resource Gains Type Count Total Average Overflow
rp_army_of_the_dead Runic Power 1.00 30.00 (0.80%) 30.00 0.00 0.00%
rp_empower_rune_weapon Runic Power 1.92 47.75 (1.27%) 24.92 0.16 0.33%
rp_soul_reaper Runic Power 24.31 238.67 (6.36%) 9.82 4.39 1.81%
rp_howling_blast Runic Power 160.45 1528.47 (40.72%) 9.53 76.08 4.74%
rp_death_and_decay Runic Power 14.20 141.96 (3.78%) 10.00 0.00 0.00%
rp_plague_strike Runic Power 38.80 388.03 (10.34%) 10.00 0.00 0.00%
rp_obliterate Runic Power 19.52 361.45 (9.63%) 18.52 28.90 7.40%
arcane_torrent Runic Power 5.49 101.81 (2.71%) 18.56 7.92 7.22%
antimagic_shell Runic Power 7.96 362.08 (9.65%) 45.48 28.06 7.19%
frost_presence Runic Power 260.19 553.20 (14.74%) 2.13 15.98 2.81%
rune_regen_all None 3189.42 220.46 (50.00%) 0.07 4.62 2.05%
rune_regen_unholy None 1057.85 70.95 (16.09%) 0.07 3.49 4.68%
rune_regen_blood None 1065.31 74.23 (16.83%) 0.07 1.13 1.51%
rune_regen_frost None 1066.26 75.28 (17.07%) 0.07 0.00 0.00%
empower_rune_weapon Rune 1.92 6.53 (6.24%) 3.40 4.97 43.25%
blood_tap Rune 49.06 49.06 (46.88%) 1.00 0.00 0.00%
blood_tap_blood Rune 14.65 14.65 (14.00%) 1.00 0.00 0.00%
blood_tap_frost Rune 14.63 14.63 (13.98%) 1.00 0.00 0.00%
blood_tap_unholy Rune 19.78 19.78 (18.90%) 1.00 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 73.66 695.24 (100.00%) 9.44 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 8.33 8.26
Combat End Resource Mean Min Max
Runic Power 33.32 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 3.1%

Procs

Count Interval
Army of the Dead: Frost 1.0 0.0sec
Army of the Dead: Unholy 1.0 0.0sec
Army of the Dead: Death 1.0 0.0sec
Soul Reaper: Frost 12.0 11.9sec
Soul Reaper: Death 12.3 12.2sec
Howling Blast: Frost 56.3 7.9sec
Howling Blast: Death 104.1 4.3sec
Death and Decay: Unholy 14.2 32.2sec
Plague Strike: Unholy 38.8 9.8sec
Obliterate: Frost 9.8 43.3sec
Obliterate: Unholy 19.5 21.9sec
Obliterate: Death 9.7 42.6sec
oblit_killing_machine 11.2 37.1sec
frost_strike_killing_machine 100.7 4.4sec
Blood runes ready 90.8 5.1sec
Frost runes ready 91.9 5.0sec
Unholy runes ready 91.8 5.0sec
Killing Machine expired naturally 1.9 107.4sec

Statistics & Data Analysis

Fight Length
Sample Data Death_Knight_Frost_2h_T18H Fight Length
Count 7499
Mean 450.52
Minimum 350.62
Maximum 556.81
Spread ( max - min ) 206.19
Range [ ( max - min ) / 2 * 100% ] 22.88%
DPS
Sample Data Death_Knight_Frost_2h_T18H Damage Per Second
Count 7499
Mean 92048.09
Minimum 86336.06
Maximum 99066.54
Spread ( max - min ) 12730.48
Range [ ( max - min ) / 2 * 100% ] 6.92%
Standard Deviation 1716.4920
5th Percentile 89257.69
95th Percentile 94932.45
( 95th Percentile - 5th Percentile ) 5674.77
Mean Distribution
Standard Deviation 19.8217
95.00% Confidence Intervall ( 92009.24 - 92086.94 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1335
0.1 Scale Factor Error with Delta=300 25151
0.05 Scale Factor Error with Delta=300 100606
0.01 Scale Factor Error with Delta=300 2515169
Priority Target DPS
Sample Data Death_Knight_Frost_2h_T18H Priority Target Damage Per Second
Count 7499
Mean 47444.37
Minimum 44023.20
Maximum 51692.71
Spread ( max - min ) 7669.51
Range [ ( max - min ) / 2 * 100% ] 8.08%
Standard Deviation 1120.1463
5th Percentile 45625.11
95th Percentile 49299.23
( 95th Percentile - 5th Percentile ) 3674.12
Mean Distribution
Standard Deviation 12.9352
95.00% Confidence Intervall ( 47419.01 - 47469.72 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2141
0.1 Scale Factor Error with Delta=300 10711
0.05 Scale Factor Error with Delta=300 42844
0.01 Scale Factor Error with Delta=300 1071107
DPS(e)
Sample Data Death_Knight_Frost_2h_T18H Damage Per Second (Effective)
Count 7499
Mean 92048.09
Minimum 86336.06
Maximum 99066.54
Spread ( max - min ) 12730.48
Range [ ( max - min ) / 2 * 100% ] 6.92%
Damage
Sample Data Death_Knight_Frost_2h_T18H Damage
Count 7499
Mean 41306455.72
Minimum 31408028.65
Maximum 51383350.77
Spread ( max - min ) 19975322.12
Range [ ( max - min ) / 2 * 100% ] 24.18%
DTPS
Sample Data Death_Knight_Frost_2h_T18H Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Death_Knight_Frost_2h_T18H Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Death_Knight_Frost_2h_T18H Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Death_Knight_Frost_2h_T18H Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Death_Knight_Frost_2h_T18H Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Death_Knight_Frost_2h_T18H Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Death_Knight_Frost_2h_T18HTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Death_Knight_Frost_2h_T18H Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=buttered_sturgeon
2 0.00 horn_of_winter
3 0.00 frost_presence
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 army_of_the_dead
6 0.00 potion,name=draenic_strength
7 0.00 pillar_of_frost
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_attack
0.00 deaths_advance,if=movement.remains>2
9 7.96 antimagic_shell,damage=100000,if=((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
A 6.96 pillar_of_frost
B 1.00 potion,name=draenic_strength,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
C 0.35 empower_rune_weapon,if=target.time_to_die<=60&buff.potion.up
0.00 blood_fury
0.00 berserking
D 5.49 arcane_torrent
0.00 plague_leech,if=disease.min_remains<1
E 24.31 soul_reaper,if=target.health.pct-3*(target.health.pct%target.time_to_die)<=35
F 3.02 blood_tap,if=(target.health.pct-3*(target.health.pct%target.time_to_die)<=35&cooldown.soul_reaper.remains=0)
G 0.00 run_action_list,name=single_target_2h,if=spell_targets.howling_blast<4&main_hand.2h
H 0.00 run_action_list,name=single_target_1h,if=spell_targets.howling_blast<3&main_hand.1h
I 0.00 run_action_list,name=multi_target,if=spell_targets.howling_blast>=3+main_hand.2h
actions.multi_target
# count action,conditions
J 5.48 unholy_blight
0.00 frost_strike,if=buff.killing_machine.react&main_hand.1h
K 19.51 obliterate,if=unholy>1
0.00 blood_boil,if=dot.blood_plague.ticking&(!talent.unholy_blight.enabled|cooldown.unholy_blight.remains<49),line_cd=28
0.00 defile
0.00 breath_of_sindragosa,if=runic_power>75
L 0.00 run_action_list,name=multi_target_bos,if=dot.breath_of_sindragosa.ticking
M 169.26 howling_blast
N 0.00 blood_tap,if=buff.blood_charge.stack>10
O 13.43 frost_strike,if=runic_power>88
P 14.20 death_and_decay,if=unholy=1
0.00 plague_strike,if=unholy=2&!dot.blood_plague.ticking&!talent.necrotic_plague.enabled
Q 46.03 blood_tap
R 135.17 frost_strike,if=!talent.breath_of_sindragosa.enabled|cooldown.breath_of_sindragosa.remains>=10
0.00 plague_leech
S 38.80 plague_strike,if=unholy=1
T 1.57 empower_rune_weapon
actions.single_target_2h
# count action,conditions
0.00 defile
0.00 blood_tap,if=talent.defile.enabled&cooldown.defile.remains=0
V 0.00 howling_blast,if=buff.rime.react&disease.min_remains>5&buff.killing_machine.react
W 0.00 obliterate,if=buff.killing_machine.react
X 0.00 blood_tap,if=buff.killing_machine.react
0.00 howling_blast,if=!talent.necrotic_plague.enabled&!dot.frost_fever.ticking&buff.rime.react
Y 0.00 outbreak,if=!disease.max_ticking
0.00 unholy_blight,if=!disease.min_ticking
0.00 breath_of_sindragosa,if=runic_power>75
Z 0.00 run_action_list,name=single_target_bos,if=dot.breath_of_sindragosa.ticking
0.00 obliterate,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains<7&runic_power<76
0.00 howling_blast,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains<3&runic_power<88
0.00 howling_blast,if=!talent.necrotic_plague.enabled&!dot.frost_fever.ticking
0.00 howling_blast,if=talent.necrotic_plague.enabled&!dot.necrotic_plague.ticking
0.00 plague_strike,if=!talent.necrotic_plague.enabled&!dot.blood_plague.ticking
0.00 blood_tap,if=buff.blood_charge.stack>10&runic_power>76
a 0.00 frost_strike,if=runic_power>76
0.00 howling_blast,if=buff.rime.react&disease.min_remains>5&(blood.frac>=1.8|unholy.frac>=1.8|frost.frac>=1.8)
b 0.00 obliterate,if=blood.frac>=1.8|unholy.frac>=1.8|frost.frac>=1.8
0.00 plague_leech,if=disease.min_remains<3&((blood.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&blood.frac<=0.95))
0.00 frost_strike,if=talent.runic_empowerment.enabled&(frost=0|unholy=0|blood=0)&(!buff.killing_machine.react|!obliterate.ready_in<=1)
c 0.01 frost_strike,if=talent.blood_tap.enabled&buff.blood_charge.stack<=10&(!buff.killing_machine.react|!obliterate.ready_in<=1)
d 0.00 howling_blast,if=buff.rime.react&disease.min_remains>5
e 0.00 obliterate,if=blood.frac>=1.5|unholy.frac>=1.6|frost.frac>=1.6|buff.bloodlust.up|cooldown.plague_leech.remains<=4
f 0.00 blood_tap,if=(buff.blood_charge.stack>10&runic_power>=20)|(blood.frac>=1.4|unholy.frac>=1.6|frost.frac>=1.6)
0.00 frost_strike,if=!buff.killing_machine.react
0.00 plague_leech,if=(blood.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&unholy.frac<=0.95)|(frost.frac<=0.95&blood.frac<=0.95)
0.00 empower_rune_weapon

Sample Sequence

012356789DJMKMMMMORRKMMPMMOQMRKMOQMMOKORMQMKMOMMORKQMMRRRKMMPQMRMMRRQMRMKRSR9AQMMMORRQMMMRRTKMMMOPQMMOMRRQMKMMRRRDJKMQMRRMRKMQ